SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011247 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011247
Domain Number 1 Region: 691-707,742-906
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-35
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 149-272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.02e-26
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 3 Region: 341-518
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-26
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 4 Region: 1-99
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.32e-25
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0031
Further Details:      
 
Domain Number 5 Region: 937-1089
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-20
Family Laminin G-like module 0.0078
Further Details:      
 
Domain Number 6 Region: 546-603
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000398
Family Fibrinogen C-terminal domain-like 0.0044
Further Details:      
 
Domain Number 7 Region: 517-553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000686
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011247   Gene: ENSGACG00000008500   Transcript: ENSGACT00000011270
Sequence length 1092
Comment pep:known_by_projection group:BROADS1:groupXVI:16728474:16768973:-1 gene:ENSGACG00000008500 transcript:ENSGACT00000011270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSGPLVSTLPQSSFQSSSQSSASYAAHNGKLNRRDGAGGWSPVVTEQEPWLQVDLRERME
VTAVATQGRFDSWDWVSSYLLLYSDTGRAWKQYRHEDGVGDGGPSETSSRADSISYHHLS
CPPPRLHFQKALRLHWGSNTQADERALVSPPRQESYVADFDGRSSLLYRFNQKSMSTVKD
VVSLRFKSHQAEGVLLHGEGQRGDYMTLELHRGRLDLYLNLGSPSLLSLPSVHLSVGSLL
DDQQWHAVHVERFNKQVNLTVDSHTQHFHAKGEGHSLEVDYEVSDEVVISPRQHVSRGVP
RDKLGGRGVSLRLRGVNPCPWVFPVLQGNVTFSCSPPQLVACTFLSAAGSFLSLPSAPSP
AGDFSARLQFRTWNPDGLLLSAWLNPERRGLELRINGSRLQLTLRGARPAKSEAVAGQRV
DDGLWHSVSVSASNQQMTLTVDGEPPAAIQLWEQLEAEGDVNLGGCPTEDCQHLTPDFQG
CVRLIVINGHPMDLNRVQQGLLGNYNELQFDTCNIRDRCLPSLCEHGGRCSQTWSSFSCD
CWGTGYSGAPCHTSIYESSCEAYRLIGSSSGFYSIDPDGSGPLGPTQVYCNMTEEKVWTV
LAHNGTAAVAVQGSSLQRPHVTRFDYGASAEQLRAVVTGSEHCQQEVVYNCKKSRLFNTK
DGSPLTWWLDRDGEKRSYWVGLLPGVQQCSCSLKENCVHRNYFCNCDADGDAWANDTGVL
SYKDHLPVSQIVIGDTNRTGSQAVHRVGPLRCYGDKSLWNTVSFYQEASYLYFPTLQAEL
ASDISFYFKTSAPSGVFLENQGLRDFIRVELAAAPSVVTFSFDVGNGPAVLTVNSHLPLN
DRQWHYVRAERNVKEASLQVDQLPLRFLQAPADGHLRLRLSSQLFVGGTASQQRGFLGCI
RTLTVNGAGFDLEERAKMAPGVTSGCPGYCSGSTSLCHNRGRCIEKSNGYVCDCSQSAYG
GTTCNQEVSVSFDMESSVTYTFQEPFSVMQNRRSQASSVSAESSSRAREDAAFSFVTSQR
PAMLLTVSTFSQQYIAVILARNGSLQIWYHLQTDGSPDVFSPVLANLADGRLHRIRIHRV
GKNLYVQVSASN
Download sequence
Identical sequences G3P0X4
ENSGACP00000011247 69293.ENSGACP00000011247 ENSGACP00000011247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]