SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011253 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011253
Domain Number 1 Region: 60-118
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000025
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 168-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000154
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 3 Region: 140-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000128
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011253   Gene: ENSGACG00000008512   Transcript: ENSGACT00000011276
Sequence length 376
Comment pep:known_by_projection group:BROADS1:groupXIX:9471926:9474423:1 gene:ENSGACG00000008512 transcript:ENSGACT00000011276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPRQQECPSTQSLLNLLRQVEKMLVVHEASYQQGLRSLRMKISALHNRTGGEESAFPSS
CSKLEPPPHGRRLGRVFGVGHEVHFLCRPGFELIGSRTRVCLDSQRWSGQQPICRRECRG
VRDGSNVLIAGFNSTGNFFRQSHCTHFLGSTRCTCDVGFTISGRDNNICTDIDECLLFPL
GRLCVHRCVNTPGSFHCLCPAGYDLSGEGRGCTDVDECEKQLHDCAAEEMCVNTFGGFRC
VRVECPRMINATYIKTSPMRCERNPCMLGDKACTQAPNSISFHFLSAVSNMSTPRVLFRV
SAARVLGDTLRFGLAGGRGHFSVQRSGRQTGALLLVAPIEGPATLEAEVEMSELERHNLL
GRYLTKVTLFVSPYGF
Download sequence
Identical sequences G3P0Y0
ENSGACP00000011253 69293.ENSGACP00000011253 ENSGACP00000011253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]