SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011268 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011268
Domain Number 1 Region: 52-283
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.35e-37
Family Nucleotide and nucleoside kinases 0.000000853
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011268   Gene: ENSGACG00000008502   Transcript: ENSGACT00000011291
Sequence length 295
Comment pep:known_by_projection group:BROADS1:groupXIII:8577449:8579883:-1 gene:ENSGACG00000008502 transcript:ENSGACT00000011291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVMTFGCNAHPLQRRTPDVLRRVRNATHLSDVTMACKSRDLSSSSESGAARVKRVSIEG
NIAVGKSTFARLMQSACRDWELVAEPVSKWQNIESGTSKGTDASPQSTVSNLLQMMYQDP
ERWSYTFQTYSCMSRLRTQLQPPPARLLRSEGTPVQVYERSIYSDRYIFALNMFELGCIN
STEWAVYQDWHSLLVEQFGHQVELEGIIYLRAPPKRCMERLRCRGRAEETGVKLEYLDKL
HVQHERWLVEKSTELHFEKLKRIPVLELDASEEFQSDPEVQEEFIRKMKNFFKAL
Download sequence
Identical sequences G3P0Z5
ENSGACP00000011268 69293.ENSGACP00000011268 ENSGACP00000011268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]