SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011343 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011343
Domain Number 1 Region: 200-264
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000000133
Family Hef domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011343   Gene: ENSGACG00000008589   Transcript: ENSGACT00000011366
Sequence length 269
Comment pep:known_by_projection group:BROADS1:groupXIX:9548391:9560015:-1 gene:ENSGACG00000008589 transcript:ENSGACT00000011366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRGTNNRTRPEAAYGSVRREHPQEPVLLGAGEAETGPLQPRGRTPRHRPCASLWEFDRQ
QLLGLPIRQLCPAAGGGRVPDCGRKGGGVRILFEDELGLADFHLPNKSCVLYVSECDVVA
GNSYKRKLVRYRNTSSHGFQELVLVEKTRLSEQYFGAMQKLVVFDLGLTLLPVGGQAEAS
QLIAQIVHGVGRENPFRRRTSSRLLDPLVLALVQHVPGVGRVKALALLERFSSIQQLCNA
APAQLEPIVGQAAAQQIHGFFHKDTAAGT
Download sequence
Identical sequences G3P170
ENSGACP00000011343 ENSGACP00000011343 69293.ENSGACP00000011343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]