SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011360 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011360
Domain Number 1 Region: 197-318
Classification Level Classification E-value
Superfamily EF-hand 2.5e-33
Family Osteonectin 0.016
Further Details:      
 
Domain Number 2 Region: 290-381
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.54e-22
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Domain Number 3 Region: 134-179
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000036
Family Ovomucoid domain III-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011360   Gene: ENSGACG00000008600   Transcript: ENSGACT00000011383
Sequence length 425
Comment pep:known_by_projection group:BROADS1:groupVI:9823329:9843070:1 gene:ENSGACG00000008600 transcript:ENSGACT00000011383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATMVGITDIACLLVPLAVLAGSTFQTDVKGVKEAEKTGNFMEDEQWLSTISQYSRKIKHW
NRFRDEVEDDYVRTGEESQGSNDNVDTTKDPCQKVKCSRHKVCVAQGDQKAVCVNRKKLE
HRLKQPALRSPDGNCQPCPISSAGPVCGSDGRSYASKCKLEQQACLIGKDLTLKCSGLCP
CATAAPASTETIHATEGCTGQDLADLGERLRDWFQLLQGNAKQNNNSKTGARTTAASSTS
VLDRSLVASCKDSIGWMFSKLDTNGDLYLDQAELAAINLDKYEVCIRPFFNSCDSYRDGK
VSTAEWCLCFWREKPPCLAVLERIQVLDGGKRKFGRFIPSCDEDGFYRKQQCDRGECWCV
DQNGGKVAGSRMRGKPDCGTMMKMAYFSYFGQGVWDGKNEEKKGRQGVEEEEGEGEEVIT
GGPIG
Download sequence
Identical sequences G3P187
69293.ENSGACP00000011360 ENSGACP00000011360 ENSGACP00000011360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]