SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011380 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011380
Domain Number 1 Region: 22-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.61e-44
Family G proteins 0.0000000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011380   Gene: ENSGACG00000008616   Transcript: ENSGACT00000011403
Sequence length 198
Comment pep:known_by_projection group:BROADS1:groupVI:9849054:9851770:-1 gene:ENSGACG00000008616 transcript:ENSGACT00000011403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFIFDWIYKSFSSVLQLLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT
SEELTIAGMTFTTFDLGGHTQARRIWKNYLPAINGIVYMVDCADHERLAEAKVELDALMT
DETISNVPVLILGNKIDRPEAVSEDGLRGMFGLHGQTTGKGKVSLKELNLRPMEVFMCSV
LKRQGYGDGFRWLSQYID
Download sequence
Identical sequences G3P1B7
ENSGACP00000011380 ENSGACP00000011380 ENSGACP00000011390 69293.ENSGACP00000011380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]