SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011556 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011556
Domain Number 1 Region: 31-121,177-292,324-444,539-599
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.02e-31
Family Glycerol-3-phosphate transporter 0.078
Further Details:      
 
Domain Number 2 Region: 455-510
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000416
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011556   Gene: ENSGACG00000008749   Transcript: ENSGACT00000011579
Sequence length 701
Comment pep:known_by_projection group:BROADS1:groupI:7779850:7794030:1 gene:ENSGACG00000008749 transcript:ENSGACT00000011579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEAGAERGRSQGNSDGAVGQPRSSPCTSLKMFLAALSFAYFAKALSGSYMKSTITQLER
RFDIPSYLIGVIDGSFEVGNLLVIAFVSYFGAKLHRPKIIAVGCVLMSIGTFIIALPHFI
IGRYEFETSVRWVVNSTQNPSPCPVGRPSDLTREAKRPQVPATGCEGDSYLSMWIYVLLG
NVLRGIGETPVQPLGISYIDDFAGEENAALYVGCVQTISVVGPVFGYLLGSLCAKIYVDI
GFVKMETITITPSDSRWVGAWWLGYLIAGVITLLSAIPFWFLPRSLPVAGPRGPDKCTAE
RTRFIKEPPLMKHKYPADENTTFIEMAKDFIPTLRTLLGHPVYLIYLCVTIIQLNSLIGM
VTYKPKYIEQHFRQSASKANFLMGVINIPAVALGMFSGGLLMKRLKLNIMEAARFAFGTS
LIGYILSLFFFAMSCDNAEVAGVTLSYTMDRISYDKHSVFASCNSDCFCSSSDWDPVCGE
NGITYVSPCLAGCTASAGSGKNTVFSNCSCVGAAGNFTATTGQCLHKEDCDGMFPYFLAL
SVVTSFIISLGGTPGYMFLIRRCIKPQLKSLALGFHALATRTLAGIPAPIYFGAIIDTTC
LKWGQKRCGGVGACRIYNTTAYRIAYLGLTLSLRTLSFLVCIPGFILLGRQLRREERSAV
HGDLANGGAELEALRKEEFVTSSADRSQQTADSSTDRETRL
Download sequence
Identical sequences G3P1T3
ENSGACP00000011556 ENSGACP00000011556 69293.ENSGACP00000011556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]