SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011618 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011618
Domain Number 1 Region: 540-829
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.18e-73
Family Protein kinases, catalytic subunit 0.000000251
Further Details:      
 
Domain Number 2 Region: 56-88
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000497
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011618   Gene: ENSGACG00000008800   Transcript: ENSGACT00000011641
Sequence length 1173
Comment pep:known_by_projection group:BROADS1:groupXV:5982697:6000377:-1 gene:ENSGACG00000008800 transcript:ENSGACT00000011641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADWEVLQNVIGQVDEPFQVILRYTSCLRTGEGTLALDSLEFIDCESDHQFLGLEAACGES
FHCENSGVCIDQSQVCNFHTDCPLGEDEGFICEVSLMTWLFNSCGASGPLGPTQAQCDST
YRNQNVSVTVGKEDPLKGVQMWRVPATNRYLISAYGAAGGKGAKNHNKRNHGVFISGTFP
LEKGDILYILVGHQGEDACPGRNPHTQRICLGESSVIEDKLRGESGVEWAGGGGGGGGAT
YIFKMEGDDLVPLLVAAGGGGNAYLEDPESSLEKLELEQYENSTMAPSTNGQTGAAGGGG
GWKDSQSSHLKAGKSLAEGAEGGSSCSLALSKLSWSTFGGFGGGGGACTAGGGGGGYRGG
DAALKDEITSDGQNGISFIHPMGEIFLQPLAAMESHGDCEIKVHLNCSHCETRSCKREKN
TQLILCLCEDDNKVLASDNVTCVSALANPSKSKPKRLLNSSSFLLPPPRADPDGLQGKMS
TSFILAVVVSTVASGVALIGTAVILMWYRRKNNLDAVNGHLWSPEYKLSKLRSSTIMTDY
NPNYCFAGKAACLNELKEVPRKNITLLRALGHGAFGEVYEGQVLGMSGDNSPLQVAIKTL
PEICSEQDEMDFLMEALIMSKFSHDNIVRCIGVSLNILPRFILLELMTGGDMKSFLRQNR
PRAGQTSSLTMRELLQMARDIAFGCRYLEENHFIHRDIAARNCLLTCPGPDRVAKIGDFG
MARDIYRASYYRKGGRAMLPVKWMPPEAFMEGVFTCKTDTWSFGVLLWEILSLGFMPYPC
KTNQEVLEFVTSGGRMDPPKSCPGPVYRIMTQCWQHCPEHRPNFSTILERIDYCSQDPDV
INTPLPVEYAPAADDKGGPTILPSDLASLTPLLVSHPVSQAFPSQLGVSSLGLGPTPLPP
QPTKPRVLLQRTQPVHQEVTSCREALQPCWAEPVPAPGLPAGGHWLHPEPSGHQPCSRNS
SSSGSQRLKNKTKNLWNPTYGSWVLESFRGKKTLAHTQSMPLSSSATTAPNTQAPHTCNA
NCEHNEAECNSAHPPPPGLCTSSTSSPSGPTKTPPSTSSHKTPTSGPVRAGTDLAKLQSF
PCGNVNYAYDEQSYEAESAPVKNSSFAPVASAGSGPGTGVWPHAASSCVPKLLLKRHASY
GHEDVRRHAKAEKPARDRDSGFSLSEDLSVNPV
Download sequence
Identical sequences G3P1Z5
ENSGACP00000011618 ENSGACP00000011618 69293.ENSGACP00000011618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]