SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011646 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011646
Domain Number 1 Region: 19-215
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-33
Family Pentraxin (pentaxin) 0.0000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011646   Gene: ENSGACG00000008819   Transcript: ENSGACT00000011670
Sequence length 219
Comment pep:novel group:BROADS1:groupXX:10254511:10256022:-1 gene:ENSGACG00000008819 transcript:ENSGACT00000011670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFLLLLVMLTACAAIPQDLSGKMFTFPQQSATSLVKLTASELLYRAVTVCHRSFTDIKR
NHVLFSLATPSIANDFLMIWDDTNKELQPHIRNAKTVYGGLDYKLNMWHSICTTWDSESG
LVQMWFDGQPTIRKFITSGSAITGSNIITLGQEQDSYGGGYDLKQSFVGMMSDVHMWDHT
LSPCEIHKYVDGLNFTPGNVLNWGALEFQITGKVIVEDK
Download sequence
Identical sequences G3P223
ENSGACP00000011646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]