SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011948 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011948
Domain Number 1 Region: 593-877
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-81
Family Protein kinases, catalytic subunit 0.000000000351
Further Details:      
 
Domain Number 2 Region: 2-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-66
Family Ephrin receptor ligand binding domain 0.000000574
Further Details:      
 
Domain Number 3 Region: 290-495
Classification Level Classification E-value
Superfamily Fibronectin type III 7.03e-38
Family Fibronectin type III 0.0000883
Further Details:      
 
Domain Number 4 Region: 891-967
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.92e-18
Family SAM (sterile alpha motif) domain 0.00014
Further Details:      
 
Domain Number 5 Region: 220-294,329-345
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000068
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011948   Gene: ENSGACG00000009051   Transcript: ENSGACT00000011972
Sequence length 970
Comment pep:known_by_projection group:BROADS1:groupVIII:11024707:11048659:-1 gene:ENSGACG00000009051 transcript:ENSGACT00000011972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTELAWTAHPETGWEEVSGYDDAMNPIRTYQVCNVRELNQNNWLRSDFIPRKDVLRVYVE
MKFTVRDCNSIPNIPGSCKETFNLFYYESDSDSATATSPFWMENPYVKVDTIAPDESFSM
LETGRVNTKVRSFGPLSRAGFYLAFQDLGACMSLISVRVFYKKCSTTIANFAVFPETATG
AEATSLVIAPGTCVPNALEVSVPLKLYCNGDGEWMVPVGACTCSSGFESAMKDTQCQACS
PGTFKSKQGDSFCLPCPANSRASSGASSVCSCRNGYYRSDADSPDSPCTTVPSAPRSVIS
SVNETSLVLEWSDPRDLGGREDIFYNVICKKCLPERGMCSRCDDNVDISPRHLGLTQRRV
AVRNLQAHTQYSFEIQAMNGVSNKSPYTPQFSAVNITTNQAAPSAVPIVHLMAATVSTMS
LSWLPPEKPNGIILDYEIKYHEKQDQGEAIAHTMTAQRSNARIEGLKARTPYVVQVRART
VAGYGRYSSPADFSTNFKNDDQKSWHDQLPLIVGSATAAFVFIIAVVVIAIVCLRSGYNL
EPCSSPQLDRKQRNGSESEYTEKLQQYITPGMKVYIDPFTYEDPNEAVREFAKEIDVSCV
KIEEVIGAGEFGEVCRGRLKLPGRREIIVAIKTLKVGYTDRQRRDFLSEASIMGQFDHPN
IIRLEGVVTKSRPVMIVTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSDMN
YVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYR
KFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLD
CWVKERNLRPKFTQIVATLDKLIRNAASLKVVTNSTQSTGVSQPLLDRCVPDYTTFTTVG
DWLDAIKMSRYRDNFVNAGFASFDLVAQMTAEIHRDLLRIGVTLAGHQKKILGSIQDMRL
QMNQTLPVQV
Download sequence
Identical sequences G3P2X5
ENSGACP00000011948 ENSGACP00000011948 69293.ENSGACP00000011948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]