SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012468 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012468
Domain Number 1 Region: 121-275,432-579
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.28e-45
Family Tandem AAA-ATPase domain 0.00027
Further Details:      
 
Domain Number 2 Region: 1719-1855
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 1.96e-18
Family XPF/Rad1/Mus81 nuclease 0.0027
Further Details:      
 
Domain Number 3 Region: 1872-1931
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000593
Family Hef domain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012468   Gene: ENSGACG00000009448   Transcript: ENSGACT00000012492
Sequence length 1933
Comment pep:known_by_projection group:BROADS1:groupXV:7288359:7320123:-1 gene:ENSGACG00000009448 transcript:ENSGACT00000012492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSNQRTLFQTWGGPVSQNKAFPPKKEDPPPLYEYDDDDDDLMVVAVSEAEKCLQLNDAN
YFRNDARVWIYPTNYPIREYQVKISEAALFRNTLVCLPTGLGKTFIAAVVMYNFYRWYPS
GKIVFMAPTKPLVAQQIEACYKVMGIPQAHMAELTGTTAANRREDVWRTKRVFFLTPQVM
ANDLSRDTCPAQQVKCVVIDEAHKALGNHAYCQVIRQLCSQTLQFRILALSATPGGDTKS
VQSVISNLLVSHIELRSEESPDIQAHSHERSVDKMVVPLGESLSAHQARYLQVLEKFMSR
LVQNRVMARKDLRTLSKYQIILARDQFRKNPPSGIKARTLLDESLGPQQGMLEGDFALCI
SLYHGYELLMQMGLRSLFFYVQGIMEGSREMPRARNELQRTPVFVDLYHEMQAMFVKPSA
GPDEPFIYSHPKLKKLEEVVLQHFRRWAESSEDSPQEVSTRVMIFSSFRESVQEIADMLN
HHAPLIRVMTFMGQASTGKAVKGFTQKEQLEVVCRFRRGGFNTLVSTCVGEEGLDIGEVD
LIVCFDAQKNPTRLVQRMGRTGRKRRGRIVVILAEGREERASTYNQSQSNKRSIHKSIIG
NKISFHMYPNSPRMLPEGVNPTMHKMHITCGQFDHQESGRRSVRGRRSHSEVRQGSTKSD
GFLTSAEYSLWASTMRLEEDEAHPTLKPSRFMCLPDDASPQVPFFCRCYLSLWEWRHWQH
KALPTHDVDHSLRCHHFVKVMELVDVMREENEGECRYEQELLPYRHKAGAVFHGKKGQKK
SKGTKTCTKSARTIAEPPPSAFSDAEYLDADEEEEADLGQTRGRSTGFTSTVATQGLPVA
DHTAASWDDITGHPGPEAICPLPSNNDRPEAGVDDDRVFINQDAIKSDQAVGDRTSQLIT
KIDDDEGVELQAMFYLPECDPGPPSFAKLPAADPSLKVILANVAELLSRSPPPTLDLAAD
MAPASLPPSPPHQPFQRRSGGTGSAAASSPTWEEVFGEEETNDDGDVRDIAMETDNDLLE
EDEGVGGDAEKFMEINIGNDGATSLGDGRQEEMADSTRGVEDARRAQMDASMDLFGDDEV
FLQITIPDISTPGAASRTPPTTGDVANRRMANASHTLTPAISCHADESSRPNHRTPSPRA
HRSEPGASETGEGIAAQRETVERSHVYYSVNFDLGYSLEDSDEAEEEAAAPCSPTSPQHR
EPAGSAAPRPAAPGSSTPCYGFRGHRKPLLSTTSTPDGLSLRRGGGTSPLPASAAVPGGG
ALPSPIASAGSRRTLVPSGPAAPSLGVGLKRKRLENRFPPRPDSFLVECSSDSEEDVAVR
KTRHQNRVKPFSSPDSKTSSDVDSPSPVVTEETEAEAVSVSDDDFQDEFGFTRRTAAHVA
ERKSAQQGNAKVRYPACRKGHQFLDVEAEMSEDGGADVSSDEEDGEEQNRSLEGFVVDNT
HLSQGLDDSEMHGVYLKSVKSPALQGRFKMSYKNRHNMDIFSQVPEVDESYAEDSFVVGS
EVESSEGEAEDVELMPEESFVEGRRQYATRRRVFLRRARAGTGGAITTGAPPERSAEAKT
KRLRVIRLDDSSEEEETGEVGKKAGLGKEAAADVPLRQKAVQTEPSGLQQQKPSSCSSST
IASKFSSLSKTQRCSVSEEQQEESVLFLYLTGGDRGWMISICSPMSSISERGERRCYPPR
KSPRFERRHTSIRSYIALHCTSAAQDSPVGRPAAPPAPVCILVDSRCIGNGAELISSLRR
SAGATVHVCSLDGGYFIVSGRMAAERHSQSDLAAMQNRKRLAERVNGLLGSFERVCLIVE
KDRTKPGEASRPPQRTRCYDSTLTALVRAGARLLWSDGAEQTAGLLVELARLEQRKGQGI
TVPLEVKGQHRQQALQLYLSLPSVNYVHALSMSHNFRSIGHLVNSSVEAIEKGGCMSRAR
AEEIYRFLRYSCD
Download sequence
Identical sequences G3P4E5
ENSGACP00000012468 69293.ENSGACP00000012468 ENSGACP00000012468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]