SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012812 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012812
Domain Number 1 Region: 55-249
Classification Level Classification E-value
Superfamily vWA-like 7.71e-53
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 2 Region: 302-342
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000000209
Family Chicken cartilage matrix protein 0.0028
Further Details:      
 
Domain Number 3 Region: 255-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000228
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012812   Gene: ENSGACG00000009713   Transcript: ENSGACT00000012836
Sequence length 345
Comment pep:known_by_projection group:BROADS1:groupXVIII:9394362:9399164:1 gene:ENSGACG00000009713 transcript:ENSGACT00000012836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSPLIGSLILRQSLLIQQLVLATYHLGVGDPQRIAAQSYAQTRTNGRPPFRTLNPQKTDS
HCRSRPMDLVFIIDSSRSVRPGEFEKVRIFLADMVDTLDVGADATRVAVVNYASTVKIEF
LLKSHFNKPDMKKAISRIEPLAAGTMTGLAIKTAVSEAFTEQSGARPLSRKITKVAIIVT
DGRPQDQVEEVSAAARASGIEIYAVGVDRADMRSLQQMASTPLDDHVFYVETYGVIEKLT
SKFKETLCGPEPCAMGHDCEHTCVNSNASYYCQCRNGYILNADKKTCSPKREELKAAEVA
VADPCKCEARLAFQKQTHAAIQQLTIPLVAVSGRIERLENTVGRA
Download sequence
Identical sequences G3P5D9
69293.ENSGACP00000012812 ENSGACP00000012812 ENSGACP00000012812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]