SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012907 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012907
Domain Number 1 Region: 515-638
Classification Level Classification E-value
Superfamily TIMP-like 6.54e-22
Family Tissue inhibitor of metalloproteinases, TIMP 0.093
Further Details:      
 
Domain Number 2 Region: 338-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000204
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 3 Region: 270-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000023
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 4 Region: 401-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000012907
Domain Number - Region: 75-148
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00421
Family APC10-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012907   Gene: ENSGACG00000009779   Transcript: ENSGACT00000012931
Sequence length 639
Comment pep:novel group:BROADS1:groupXVII:9900355:9904073:-1 gene:ENSGACG00000009779 transcript:ENSGACT00000012931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGRGRHQMLVALCWLFLVLTRSAAGEISRCEGHACSPPIRNLATGRILFTRSSCCGNSSL
HHRTCVIPDLLCPEDPHPSAHMTDDPFLHPDTWWASAAGIGMQGEQDEIRLDLETRFCLS
HVVLVFRSPRPAAMAVERSADFGKTWEALKLFAHNCSMEFGLPDDFTQPGSLCTSRYTSA
APCSRGEVILRTLDPSSVTGLNPYSPETLARLTLTNLRIRLLKAQTCAAPLIPPKELTSP
TASALTSTSTRGSPASAPYAIYTLLARGTCLCHGHAEHCSPHNSSHDRRGGSDMVPGRCL
CTHHTAGDHCERCAPLYNDHPWRPANSSSGESNPCRKCQCHGHADSCHFSRRAWLSSGGT
SGGVCDGCRHNTVGRRCQRCRHGYHRHPALPLNSPHACTRCWCDPQGSLPTHPGEEGPWC
HPRSGQCHCKYGVGSTSCDHCLPGYWGFGEGRCKPCACPRNCDPTTGQCLHSNSNDQMFD
VPVGGRIPDLDPMVTIEEEVRWSKELAVSAMHYTGKCDCKEKKLRSVSDLCKIKHDYAIK
AIVLSAHDKGSHAEVQVNVRKVLQSGNLPLYLGTIGIYPLSWTSRGCTCPVLNPGMEYLL
AGPEEDGTGRLLVTMQSAVVPWTPRLGLLVSEGLRIGCA
Download sequence
Identical sequences G3P5N4
ENSGACP00000012907 ENSGACP00000012907 69293.ENSGACP00000012907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]