SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013389 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013389
Domain Number 1 Region: 425-698
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.53e-66
Family Eukaryotic proteases 0.0000965
Further Details:      
 
Domain Number 2 Region: 189-302
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-22
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 3 Region: 29-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-20
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 4 Region: 372-444
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000556
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 5 Region: 317-375
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000181
Family Complement control module/SCR domain 0.0052
Further Details:      
 
Domain Number 6 Region: 142-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000259
Family EGF-type module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013389   Gene: ENSGACG00000010132   Transcript: ENSGACT00000013414
Sequence length 698
Comment pep:known_by_projection group:BROADS1:groupXX:11706006:11710151:1 gene:ENSGACG00000010132 transcript:ENSGACT00000013414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIVLFSNRFDRFRMMRLSLLLLLLHRPACSLLLGWVDSPGYPAGYLPHASLNWSRCAPK
GHTLSIRLMHLDLEESKDCENDAVKIFSNGNLISVLCGGREFEDLESNVNPSLLSSPGGC
LSLTFHSDYSNTKRHTGFRGFYTDQDFDECNDDPDNACTHFCHNHIGGYRCSCRHGYYLD
GDNHTCTVSCSEDLSGRHSGDISSPSWPASYAENANCQHTLSVEPTLQLEMHFSEDFDVE
QSPDGQCIDALTIETRNPSRILGPFCGHSPPPSPFLTHSHHVKIRFTSDGYGSNKGFTIH
FKTRAKVCPAVVTPYSTATPQQPEYHEGQTVTVTCDLGYIINSQEETRTEYVAHCQNTGE
WTPNNICEPVDCGVPEIPEDGILQLVYSDELNTQYKDQIHFTCSSKYYTLEGDDTYTCSA
SGDWVSGGDKKEMPKCTEVCGKPEKHHASVARILGGRDATMGEIPWILLIKWPNRGGASL
INDRWAVTAAHVVELVEESSLKLYGGLVDGRTISDALSNVVVMESEKIIIHPNYITGIPL
SERTNFDNDIALIRLASRVNFGPNLLPICLPEVNSVMTEGEQGTVSGWGKTESRSASPSL
KYAHIGVYSLAVCANTPYIPATDQHMTMTANMFCAGAPGKDSCQRDSGSPFVSPMLAEGN
EPYFLTGIVSWGPPCQQRQYKGYYTKVAGYVDWIKETM
Download sequence
Identical sequences G3P715
ENSGACP00000013389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]