SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013407 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013407
Domain Number 1 Region: 420-687
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.77e-73
Family Eukaryotic proteases 0.0000946
Further Details:      
 
Domain Number 2 Region: 174-289
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-22
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 3 Region: 14-128
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-20
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 4 Region: 293-363
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 5 Region: 360-432
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000556
Family Complement control module/SCR domain 0.00075
Further Details:      
 
Domain Number 6 Region: 127-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000789
Family EGF-type module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013407   Gene: ENSGACG00000010132   Transcript: ENSGACT00000013432
Sequence length 688
Comment pep:known_by_projection group:BROADS1:groupXX:11706057:11715524:1 gene:ENSGACG00000010132 transcript:ENSGACT00000013432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSLLLLLLHRPACSLLLGWVDSPGYPAGYLPHASLNWSRCAPKGHTLSIRLMHLDLEE
SKDCENDAVKIFSNGNLISVLCGGREFEDLESNVNPSLLSSPGGCLSLTFHSDYSNTKRH
TGFRGFYTDQDFDECNDDPDNACTHFCHNHIGGYRCSCRHGYYLDGDNHTCTVSCGGGIF
DELEGHLFSPGYPTPPPHAVSCQYIISVEPGFTVALNFTDIFHIESVQTEQGPNCLHHWL
QVTIPDREPMKLCGEKSPDLIVTDSNTIRLDYHTDDEGLSKGWSLDYSTHRVKCPFPGNL
ANGRVTPILTEYFYRDYIFVRCDQGYKLMMDGEEVEGFSTMCQSNAQWHLPLPECHILDC
GEPESLLNGGVTFLSGLQNQYLSVIQYHCNEPFYSLLGGANVVYTCEADRRWRSNSSIVV
RPTCIPVCGQPTTLLSSYQRIIGGSDAPENSIPWQVLLSLNGHRGGGMVIGDRWIMTAAH
NVMANGNPVSSENVRIFMGLNDVNTLLVSPVIAASIHIHPQYNNPNYVDFNHDIALIKMQ
DPVTFNSSIMPICLPAEGTAYIPGTMGLVTGFGVTATTRGRILTNKMKYVHVPVVTQETC
SNSITLLKKTGTNVPSLTNNMFCAGVPEGGKDSCQGDSGGPYALRNDGRFWAAGIVSWGV
ECGKQGAYGVYTKVDQYRDWIDKTMQEN
Download sequence
Identical sequences G3P733
ENSGACP00000013407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]