SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013420 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013420
Domain Number 1 Region: 442-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.33e-72
Family Eukaryotic proteases 0.0000936
Further Details:      
 
Domain Number 2 Region: 35-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-29
Family Spermadhesin, CUB domain 0.00011
Further Details:      
 
Domain Number 3 Region: 196-311
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-22
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 4 Region: 315-385
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000025
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 5 Region: 382-454
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000598
Family Complement control module/SCR domain 0.00075
Further Details:      
 
Domain Number 6 Region: 143-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000156
Family EGF-type module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013420   Gene: ENSGACG00000010132   Transcript: ENSGACT00000013445
Sequence length 721
Comment pep:known_by_projection group:BROADS1:groupXX:11711149:11715744:1 gene:ENSGACG00000010132 transcript:ENSGACT00000013445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFNPEMGWTLCIILVLHVSVCECWPLPDPEPLMHGALQSPQYPQPYPPNLLEQWELSVP
EGYQIQITFTHLDIEASAGCYYDALTVLYDAKILGKFCGHENSADGHHPGNQPILSPGNR
LSLTFQTDNNNPERHQNVGFSAQYQAIDMDECSAPRPQDDPDPLCSHICLNTLGSYLCAC
HHGYELRPDQRSCVLSCGGGIFDELEGHLFSPGYPTPPPHAVSCQYIISVEPGFTVALNF
TDIFHIESVQTEQGPNCLHHWLQVTIPDREPMKLCGEKSPDLIVTDSNTIRLDYHTDDEG
LSKGWSLDYSTHRVKCPFPGNLANGRVTPILTEYFYRDYIFVRCDQGYKLMMDGEEVEGF
STMCQSNAQWHLPLPECHILDCGEPESLLNGGVTFLSGLQNQYLSVIQYHCNEPFYSLLG
GANVVYTCEADRRWRSNSSIVVRPTCIPVCGQPTTLLSSYQRIIGGSDAPENSIPWQVLL
SLNGHRGGGMVIGDRWIMTAAHNVMANGNPVSSENVRVNQNFHSVDFQIFMGLNDVNTLL
VSPVIAASIHIHPQYNNPNYVDFNHDIALIKMQDPVTFNSSIMPICLPAEGTAYIPGTMG
LVTGFGVTATTRGRILTNKMKYVHVPVVTQETCSNSITLLKKTGTNVPSLTNNMFCAGVP
EGGKDSCQGDSGGPYALRNDGRFWAAGIVSWGVECGKQGAYGVYTKVDQYRDWIDKTMQE
N
Download sequence
Identical sequences G3P746
ENSGACP00000013420 69293.ENSGACP00000013420 ENSGACP00000013420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]