SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013480 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013480
Domain Number 1 Region: 3253-3405
Classification Level Classification E-value
Superfamily C-type lectin-like 1.5e-39
Family C-type lectin domain 0.00000358
Further Details:      
 
Domain Number 2 Region: 119-228
Classification Level Classification E-value
Superfamily C-type lectin-like 6.59e-36
Family Link domain 0.0015
Further Details:      
 
Domain Number 3 Region: 230-341
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-26
Family Link domain 0.0076
Further Details:      
 
Domain Number 4 Region: 2-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000108
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 
Domain Number 5 Region: 3406-3466
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000417
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 6 Region: 3202-3243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000722
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013480   Gene: ENSGACG00000010187   Transcript: ENSGACT00000013505
Sequence length 3507
Comment pep:known_by_projection group:BROADS1:groupXIII:10009538:10044666:1 gene:ENSGACG00000010187 transcript:ENSGACT00000013505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTGSLSGKVNLPCFFSIIPTSAPSVVSNATALYNRDYLRIKWTKIDGDVESTVLVAQNGV
IKIGSSYRNRVSVPSHPEDVGDSSLTMVKLRASDAGTYRCEVIYGIEDTQDTVNLDVNGV
VFHYRTSTNRYTLDYPSAVQACQNVGATIATYDQLKAAYEDGFDQCDAGWIADQTVRYPI
TRPRKGCYGNLLTKPGVRSYGNRKETKTYDVYCYVDKLDGEVYYAPVTRKMTFEEASAEC
KARNAVLASPGQLHAAWRHGLDRCDYGWLSDGSVRHPVAVARVKCGGGLLGVRTMYRYRN
QTGFPEPTMKLGAYCFKEDDLIIKDTTDTTFAPTLEDTVSKSTQKTVPGPAATHSTEGMT
HVTSTAADFVPTITPAEPQITKATAQTQTQKAKKESTSVIPTSVLEETAKTEVTPVVYLG
KTESSASVSPIIADTSPVTSSVDSTGTPKTEMSPKAEETEATRGAKKASMTTESNVSLPK
TENNTWEPSSTSAVPKTTVSDIENEEESSQTTLLESIPSISQIAKEPKTASSLITLVSEG
FGDSTESPSVTASSQTQTSNTSTSTVTIASSLYSTEKPTSESPETKESVSTSQTEKLSAS
AKTTSTLSTTDEDGSGDQTENMFTQTSSVIAKSSPYTTVVPSTSRVTSSVTSEIKVEDIG
SESTMVESISLISESTMTLETSSFPITIDSDSSGDSTDNFTEESHSKTTTVSSSWTTESP
SVTASSQTQTSNTSTSTVTIASSLYSTEKPTSDSGDSTDNFTEESHSKTTTVSSSWTTES
PSVSASSQTQTTKSSPYTTEVLSTSRVTSSVTSEIEVEDIGSESTMVESISLISESTMTL
ETSSFPITIDSDSSRDSTDNFTDESHSKTTTVSSSWTTESPSVTASSQTQTSNTSTSTVT
IASLLYSTEKPTSESPETKESVSTSQTEKLSASAKTTSTLSTTDEDGSGDQTESPSVTAS
SQTQTSNTSTSTVTIASLLYSTEKPTSESPETKESVSTSQTEKLSASAKTTSTLSTTDED
GSGDQTENMFTQTSSVIAKSSPYTTEVPSTSPVTSSVTSEIEVEDIGSESTMVESISLIS
ESTMTLETSSFPITIDSDSSGDSTDNFTEESHSKTTTVSSSWTTESPSVTASSQTQTSNT
STSTVTMASSLYSTEKPTSESPETKESVSTTKSSPYTTEVPSTSPVTSSVTSEIEVEDIG
SESTMVESISLISESTMTLETSSFPITIDSDSSGDSTDNFTEESHSKTTTVSSSWTTESP
SVTASSQTQTSNTSTSTVTIASSLYSTEKSTSESPETKESVSTSQTEKLSASAKTTSTLS
TTDEDGSGDQTENMFTQTSSVIAKSSPYTTEVPSTSPVTLSVTSEIEVEDIGSESTMVDQ
TQTSNTSTSTVTIASSLYSTEKPTSESPETKTTESPSVTASSQTQTSNTSTSTVTIASSL
YSTEKPTSESPETKESVSTTKSSPYTTVVPSTSRVTSSVTSEIKVEDIGSESTMVESISL
ISESTMTLETSSFPITIDSDTSGDSTDNFTEETHSKTTTVSSSWTTESPSVTASSQTQTS
NTSTSTVTIASSLYSTEKPTSESPETKESVSTSQTEKLSASAKTTSTLSTTDEDGSGDQT
ENMFTQTSSVIAKSSPYTTEVPSTSPVTSSVTSEIETTESPSVTASSQTQTSNTSTSTVT
IASSLYSTEKPTSESPETKESVSTSQTEKLSASAKTTSTLSTTDEDGSGDQTENMFTQTS
SVIAKSSPYTTEVPSTSPVTSSVTSEIEVEDIGSESTMVESISLISESTMTLETSSFPIT
IDSDSSGDSTDNFTEESHSKTTTVSSSWTTESPSVTASSQTQTSNTSTSTVTIASSLYST
EKPTSESPETKESVSTSQTEKLSASAKTTSTLSTTDEDGSGDQTENMFTQTSSVIAKSSP
YTTEVLSTSPVTSSVTSEIEVEDIGSESTMVESISLISESTMTLETSSFPITIDSDSSGD
STDNFTEESHSKTTTVSSSWTTESPSVTASSQTQTTKSSPYTTEVPSTSPVTSSVTSEIE
VEDIGSESTMVESISLISESTMTLETSSFPITIDSDSSRDSTDNFTEESHSKTTTVSSSW
TTESPSVTASSQTQTNSSRDSTDNFTDESHSKTTTVSSSWTTESPSVTASSQTQTKFHSK
TTTVSSFWTTESPSVTASSQTQTSNTQQVTISDSFQSNSNNESTMTLETSSFPITIDSDS
SGDSTDNFTDESHSKTTTVSSSWTTESPSVTASSQTQTSNTSTSTVTIASLLYSTEKPTS
ESPETKESVSTSQTEKLSASAKTTSTLSTTDEDGSGDQTENMFTQTSSVIAKSSPYTTEV
PSTSPVTSSVTSEIEVEDIGSESTMVESISLISESTMTLETSSFPITIDSDSSGDSTDNF
TDESHSKTTTVSSSWTTESPAVTASSQTQTSNTSTSTVTIASSLYSTEKPTSESPETKES
VTTSQTEKLSASAKTTSTLSTTDEDGSGDQTENMFTQTSSVIAKSSPYTTSESTMTLETS
SFPITIDSDSSGDSTDNFTEESHSKTTTVSSSWTTESPSVTASSQTQTTKTTSTLSTTDE
DGSGDQTENMFTQTSSVIAKSSAYTTEVPSTSPVTSTVTSVIEVEDIGSESTMVESISLI
ITTTFIEEKSSSDREFLTVTTIPYRFETSQPLAVPSVTVYHSKETSTFIDMESSGGLLAE
DDLESSSDGSGTDVSVETTSKPQEEGTVATDETEIDETDRTSAMSTAASSTLSSTHPIRQ
FIPSTQSPHITSTEVYNIEHGSGVFPDDSAEASAAAVSQEGKITPETHSPTASEASTLPL
SSIGEYKVSVAEDTTQSSYTTMSPWTIGVSVSDRSTVELTTLSSMSEQKPDRSTLMSSAI
PSIIYHSITDQQVMIITPSSSQSKTDQTEQTPTMILHVSKPSTSTTIIFTEDAKDEDDLF
SAVTDTMKTSTDDTVTSAPQSTPATTLSTKSSSEETTDLSTPHTGFLIGTDTKPFPEQAE
EDLSGKDTADNVTHSIVAITPTPASTDPATVKSSSEAVISTVSSPFSTERPTVALDTGLK
DGDISVNRNQSMLTEGMPTSPVTVSVSSREPSTDGTKIAASSLYSTEKPTVTPSSKVTGT
MKMDQMLTLSPPYSTAPDSVESSSSSESGSESTGSSEEEGKPDKDTVHIGGESLIRGEET
TVITDTALGQTIVGETVEIQGVNSCTENICLNGGSCSKSGSIYICTCAPGYSGDLCETDF
DECQSNPCRNGGTCVDRLASFTCVCLPSYSGLHCEEDTETCEYGWHKFQGQCYKYFPHRR
NWDTAERECRMHGAHLCSIVAHEEQQFVNRLGQDYQWIGLNDKMFDSDFRWTDGSPVHYE
NWRPNQPDSFFSSGEDCVVMIWHEDGQWNDVPCNYHLTFTCKKGTVACNQPPLVENARTF
GRKRERYEINALVRYQCQTGFIQRHVPTIRCRGDGRWDNPKITCMNPTASGYQRTFIRRH
QHSSLYSINNFKRWPDEPFRFHQQRYR
Download sequence
Identical sequences G3P7A6
69293.ENSGACP00000013480 ENSGACP00000013480 ENSGACP00000013480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]