SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014092 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014092
Domain Number 1 Region: 417-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 2 Region: 286-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family Laminin-type module 0.072
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000014092
Domain Number - Region: 474-518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000555
Family Laminin-type module 0.039
Further Details:      
 
Domain Number - Region: 521-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 130-183
Classification Level Classification E-value
Superfamily Sialidases 0.0451
Family Sialidases (neuraminidases) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014092   Gene: ENSGACG00000010651   Transcript: ENSGACT00000014117
Sequence length 550
Comment pep:known_by_projection scaffold:BROADS1:scaffold_133:56635:73354:-1 gene:ENSGACG00000010651 transcript:ENSGACT00000014117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQRLLALLVMLALGQCQFDVCRSLRSSEAGPGWEFYSCQPSTVNMKEVMQIRVDPPGVTC
GNPPERFCTLENPYLCSDECDASSPDLSHPPQLMGDRERGGLITYWQTVTWTRYPEPLLA
NITLSWNKSLEVVDDIIVSFEYGRPTAMVLEKSMDKGVTWQPYQYYADDCLEVFGMSPKR
VSDLAPSNLTRIICTEQYSRWVGAKEEKNMVFEVRARFGVFAGPKLINMDALYLRMETMK
GLRDFFTFTNLRLRLLRPALGGTYVQRDNLLKYFYAISNIDVPARCKCNLHAAQCVLRDA
TLQCECDHNTSGQDCQLCNQGFKSRSWRPGSYLPLPKGTANTCNSISTSSSTSTNSPTIP
GLGTDSEIEGTFPGEETAASGPAEGSESDENTLFFIHPQTPSFLSPFLVFLVFPSDCECN
GHSNRCSYIDFINVVTCVSCKHNTRGQNCQFCRLGYYSNALLSLDDENVCVASQCHQDGS
ASPHCSDSGFCQCKDGATGRRCDTCLPGYTWRGGGASCTVNMCDEEDLICQNGGTCVNLQ
RCVCLDGFTG
Download sequence
Identical sequences G3P918
ENSGACP00000014092 69293.ENSGACP00000014092 ENSGACP00000014092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]