SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014162 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014162
Domain Number 1 Region: 74-129
Classification Level Classification E-value
Superfamily L domain-like 0.00000826
Family Internalin LRR domain 0.059
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000014162
Domain Number - Region: 168-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.041
Family Merozoite surface protein 1 (MSP-1) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014162   Gene: ENSGACG00000010698   Transcript: ENSGACT00000014187
Sequence length 234
Comment pep:known_by_projection group:BROADS1:groupXVIII:10698980:10701159:-1 gene:ENSGACG00000010698 transcript:ENSGACT00000014187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMKAGCNQLKPAVLVLIVKLCFCASYQPKDLQVCELCSGAVLNGSAVGQFCSSSAGRIE
GRCCLRRDNTSDPERITGLDLSNCSLTHVEGLLGTSRAIMMIDLSLNPIVNISDAAFQGL
IELDFIILPEHVHCPGGNTSWAKVEVKGGNRLCEGQINWCNQTGQLSINCPENSLCAPYG
PSFFECSCVDDFHGYKCLRRGEFPGLLVFGPLGAVTVAASLLLWVTQRRKVKPL
Download sequence
Identical sequences G3P988
ENSGACP00000014162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]