SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014292 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014292
Domain Number 1 Region: 158-308
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.97e-38
Family Tex RuvX-like domain-like 0.0000651
Further Details:      
 
Domain Number 2 Region: 2-156
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 1.57e-33
Family Tex N-terminal region-like 0.008
Further Details:      
 
Domain Number 3 Region: 310-397
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.37e-23
Family Tex HhH-containing domain-like 0.00074
Further Details:      
 
Domain Number 4 Region: 538-619
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000679
Family Cold shock DNA-binding domain-like 0.0017
Further Details:      
 
Domain Number 5 Region: 451-529
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000145
Family Tex HhH-containing domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014292   Gene: ENSGACG00000010794   Transcript: ENSGACT00000014317
Sequence length 625
Comment pep:known_by_projection group:BROADS1:groupVI:13691211:13722404:-1 gene:ENSGACG00000010794 transcript:ENSGACT00000014317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAKDPETLTYVKTLCENSFVTIQSSVSKSALKQNKNKDIDKFHLYLDFTCNIQRIQPHQ
TLAINRGENLKILTVKVNIPDRLKNDFMSWCINNRWRPRTFAKDELRAIIKNAVEDSYKR
LILPFLTRSYRTKLTTAAEKESIAMFVRNLRQRLLVCPVRGCVIMGVDPGFRHGCKLAFL
SPTSQILHTDVVYLHNAGNQREADKLRHLMIKYSCSKVVIGNGTACRETESVFADLISRR
CFHPLDVSYCITSEAGASIYSVSPEAVKELPDMDPNLRSAVSTVSIGRRVQDPLAELVKI
DPKHIGIGTYQHDVSAGALKAALDGVVQECVSFVGVDINICSETLMRHVAGLNAGRARNI
SEWREQNGPFNNREQLKLVKGTGPKTYQQCAGFIRINPQTLRRCASSSSGNYSTFHSGPN
SANSSPRPVPEKPAAKKGKGKTGVNVPTSFNPLDQTCIHPESYHVAQSFLSLVGGSADQI
GSAGLRQCVESKVRTSGVGELAKTLGSTPETLKLIIDGLTQPPGFDIRQNFGQADFKRGV
VSMSDLRVGAVLTGRVDNTALFGAFVDIGVGRSGLIHKSNITLDKLPASQRRRSLALGPG
ERVEVRVLDVDPHRGRIGLDLIRIL
Download sequence
Identical sequences G3P9L8
ENSGACP00000014292 69293.ENSGACP00000014292 ENSGACP00000014292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]