SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014442 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014442
Domain Number 1 Region: 66-260
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.27e-59
Family Astacin 0.0000938
Further Details:      
 
Domain Number 2 Region: 382-485
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-37
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 3 Region: 267-376
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-35
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 4 Region: 687-798
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-35
Family Spermadhesin, CUB domain 0.00015
Further Details:      
 
Domain Number 5 Region: 532-642
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-35
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 6 Region: 823-916
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-29
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 7 Region: 641-684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000157
Family EGF-type module 0.008
Further Details:      
 
Domain Number 8 Region: 487-530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000441
Family EGF-type module 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014442   Gene: ENSGACG00000010897   Transcript: ENSGACT00000014468
Sequence length 927
Comment pep:known_by_projection group:BROADS1:groupXIII:12056151:12072942:-1 gene:ENSGACG00000010897 transcript:ENSGACT00000014468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAAFLGDIALDEEDLRFFKVDRIIDLAQRTVQIVNHTVLNLNNPISAKSSQNSRGSLRNK
RAATSRPERVWPEGVIPYVISGNFSGSQRAIFRQAMRHWEKHTCVTFVERTQEESYIVFT
YRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVSIIRD
NIQPGQEYNFLKMEPGEVDSLGEVYDFDSIMHYARNTFSRGIFLDTILPRYDVNGVRPPI
GQRTRLSKGDITQARKLYKCSRCGDSLQDSSGNFSSPGFPNGYSAYMHCIWRISVTPGEK
IILNFTSMDLYRSHLCWYDHVEIRDGYWRKAPLKGRFCGDKLPEPIVSTDSRLWIEFRSS
SNWVGKGFSAVYEAICGGEVKKDSGQIQSPNYPDDYRPNKMCIWKITVAQGFHVGLTFQS
FEIERHDSCAYDYLEVRDGNSESSPLLGRFCGYDKPDDIKTSSNQLWMKFVSDGSVNKAG
FAANFFKEMDECSKPDNGRCEQRCVNTLGSYKCACDPGYELAADKRSCEAACGGFITKLN
GSITSPGWPREYPPNKNCIWQLVAPTQYRITLLFDVFETEGNDVCKYDYVEVRSGLSADS
RLHGKFCGAEKPEAITSQYNNMRIEFKSDNTVSKKGFKAQFFSDKDECSKENGGCQHECV
NTFGSYSCQCRSGFVLHDNKHDCKEAGCDHTVNSVNGVITSPNWPDKYPSKKACTWALTT
TPGHRIKIAFNELDMEAHLECAYDHIEIYDGRDGKAPSLGRFCGTKKPQPITSSASKLFV
RFFSDNSVQKKGFEASHSAECGGRLKAEVKTKDLFSHAQFGDNNYPGASDCQWVISAEKG
YGVELIFQTFEIEEEADCGYDYMELFDGADTKSPRLGRYCGSGPPEEIYSAGDSIVIKFR
SDDTINKKGFHVRYTSTKFQDTLHSRK
Download sequence
Identical sequences G3PA18
ENSGACP00000014442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]