SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014578 from Gasterosteus aculeatus 76_1

(show help)
Strong hits

Sequence:	ENSGACP00000014578
Domain Number 1	Region: 138-205
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.00000000000000202
Family	Complement control module/SCR domain	0.00087
Further Details:

Domain Number 2	Region: 81-149
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.0000000000000473
Family	Complement control module/SCR domain	0.0019
Further Details:

Domain Number 3	Region: 193-256
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.00000000000153
Family	Complement control module/SCR domain	0.001
Further Details:

Domain Number 4	Region: 39-91
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.00000000000848
Family	Complement control module/SCR domain	0.0028
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSGACP00000014578 Gene: ENSGACG00000011017 Transcript: ENSGACT00000014604
Sequence length	257
Comment	pep:novel group:BROADS1:groupXII:14228524:14229902:-1 gene:ENSGACG00000011017 transcript:ENSGACT00000014604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MDVTYVLLLSSLGLAQVIAQDCLIPVGGNNMGFKDDLPQTFPNGTKVSFECNVGYNPAGS PSITCTNGTWSPVKLTCERKSCGSAGEVENGDLNYEGTEFGDRLVVTCKTGYILVGVSQF TCGKDGWLGGRLPVCEAVACDAPPMLTNGDFSPVSDSYNYPEVVLYKCQKDYTMNGSSSS SCSKDGTFKPAPPTCIRVQCKDPDVTNGEWMSGARPPYKYKSAVTLQCIPGYNMNGAQTQ RCELNSQWAPGLPTCER
Download sequence
Identical sequences	G3PAF4 69293.ENSGACP00000014578 ENSGACP00000014578 ENSGACP00000014578

SEARCH