SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014578 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014578
Domain Number 1 Region: 138-205
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000202
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 2 Region: 81-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000473
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 193-256
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 39-91
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000848
Family Complement control module/SCR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014578   Gene: ENSGACG00000011017   Transcript: ENSGACT00000014604
Sequence length 257
Comment pep:novel group:BROADS1:groupXII:14228524:14229902:-1 gene:ENSGACG00000011017 transcript:ENSGACT00000014604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVTYVLLLSSLGLAQVIAQDCLIPVGGNNMGFKDDLPQTFPNGTKVSFECNVGYNPAGS
PSITCTNGTWSPVKLTCERKSCGSAGEVENGDLNYEGTEFGDRLVVTCKTGYILVGVSQF
TCGKDGWLGGRLPVCEAVACDAPPMLTNGDFSPVSDSYNYPEVVLYKCQKDYTMNGSSSS
SCSKDGTFKPAPPTCIRVQCKDPDVTNGEWMSGARPPYKYKSAVTLQCIPGYNMNGAQTQ
RCELNSQWAPGLPTCER
Download sequence
Identical sequences G3PAF4
ENSGACP00000014578 ENSGACP00000014578 69293.ENSGACP00000014578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]