SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014624 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014624
Domain Number 1 Region: 4-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000137
Family Laminin-type module 0.003
Further Details:      
 
Domain Number 2 Region: 54-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000114
Family Laminin-type module 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000014624
Domain Number - Region: 119-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family Laminin-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014624   Gene: ENSGACG00000011057   Transcript: ENSGACT00000014650
Sequence length 275
Comment pep:novel group:BROADS1:groupXII:14380653:14390457:-1 gene:ENSGACG00000011057 transcript:ENSGACT00000014650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CERCDCNGHASSCDKETGNCLQCLHNTAGPRCERCQDGFYGNPVTDGAQACQPCPCPGTA
SNNQFTLTCYLEADGQPTCQGCPTGYTGRRCERCEPGFIGNPLLGQRCSVDNNDNCYDCD
ERGSEGCNGDVCHCKLNVEGPSCSNCKAGSFHLSRDVKDGCLSCFCMGVTQQCSSSTHYR
DTVSSVFSPGNFQGFALVNRQRTNRISTGFTVEVSTEGTQLSYTNFDYLGQEPHYWQLPG
IFQDDKVGSYGGKIKYSISYVAGPRGSPIDDADVQ
Download sequence
Identical sequences G3PAK0
ENSGACP00000014624 ENSGACP00000014624 69293.ENSGACP00000014624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]