SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014690 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014690
Domain Number 1 Region: 6-51,91-243,321-414
Classification Level Classification E-value
Superfamily DNase I-like 7.07e-38
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014690   Gene: ENSGACG00000011085   Transcript: ENSGACT00000014717
Sequence length 414
Comment pep:known_by_projection group:BROADS1:groupXIII:12308745:12319134:-1 gene:ENSGACG00000011085 transcript:ENSGACT00000014717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METFTDVLLVTANVGSLFDNVGEIQNEWLQELYTTVHRHNPQFIALHFQEVGGKDYMVNM
GHAENFFREEMKDFDRVCIYVDNQFQAEDSFTALGSLYFIRKTLKNIYQYDFNVKEFKAV
SGRNKHVGPLEGVATVEIEKFSKNFWPDFKWSRKGFMRTRWIIHNQGLDLVNVHLFHDAS
NLVACSSSPSIYSANRKNALRYVINRISDSRYTPLPFIVFGDFNFRLDTLSLVQHLSTAA
DVQTVKRECSNEVEKIICEEKDNDRQVIKPSSVKTTAISFFNLVQDSLDPLSSYRQVLLR
IEEKLFVYLHHAVFQENNGGELLKYDKEVAAFHDVIKEEDIGFPPSYPYSEEYTKPTQYM
NTRCPAWCDRILMSHSAQEFIHKGEDGEKCVVYNTVGPRVCMGDHKPVFLFFSL
Download sequence
Identical sequences G3PAR6
ENSGACP00000014690 ENSGACP00000014690 69293.ENSGACP00000014690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]