SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015038 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015038
Domain Number 1 Region: 31-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 113-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 71-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015038   Gene: ENSGACG00000011379   Transcript: ENSGACT00000015066
Sequence length 334
Comment pep:known_by_projection group:BROADS1:groupXIX:13898537:13927745:-1 gene:ENSGACG00000011379 transcript:ENSGACT00000015066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLFLLSSCVVLFVCRPESQLLPGNNFTTECNIPGNFMCGDGKCVPGGWQCDGFPDCFDM
SDEKGCPKVKSKCAPTFFACANGVHCIIGRFRCNGFSDCPDGSDEENCTGNPLVCSEARF
KCRNGHCVDRSFLCNGQDNCQDNSDEERCLTTADPSEAPGQDFVTLDYRMRYHPSITYAV
IGSAVIFVLVVALLALVLHHQRKRSVLLPRGTHHHQPLLLSRLVILDRGHGHAGGPGLSP
GSPSGGVQYNSTPSNTAGLSVDSPPSYAQAVLDVSRPPWFDLPPPPYLSDAELPSEGELP
QYEGPQDPLSYTRAQPAAPSTPRTEASAPEQSSS
Download sequence
Identical sequences G3PBR4
69293.ENSGACP00000015038 ENSGACP00000015038 ENSGACP00000015038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]