SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gasterosteus aculeatus 76_1 > ENSGACP00000015038

Domain assignment for ENSGACP00000015038 from Gasterosteus aculeatus 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSGACP00000015038
Domain Number 1	Region: 31-67
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000131
Family	LDL receptor-like module	0.0012
Further Details:

Domain Number 2	Region: 113-150
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000262
Family	LDL receptor-like module	0.0015
Further Details:

Domain Number 3	Region: 71-109
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.00000000034
Family	LDL receptor-like module	0.0016
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGACP00000015038 Gene: ENSGACG00000011379 Transcript: ENSGACT00000015066
Sequence length	334
Comment	pep:known_by_projection group:BROADS1:groupXIX:13898537:13927745:-1 gene:ENSGACG00000011379 transcript:ENSGACT00000015066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	SLLFLLSSCVVLFVCRPESQLLPGNNFTTECNIPGNFMCGDGKCVPGGWQCDGFPDCFDM SDEKGCPKVKSKCAPTFFACANGVHCIIGRFRCNGFSDCPDGSDEENCTGNPLVCSEARF KCRNGHCVDRSFLCNGQDNCQDNSDEERCLTTADPSEAPGQDFVTLDYRMRYHPSITYAV IGSAVIFVLVVALLALVLHHQRKRSVLLPRGTHHHQPLLLSRLVILDRGHGHAGGPGLSP GSPSGGVQYNSTPSNTAGLSVDSPPSYAQAVLDVSRPPWFDLPPPPYLSDAELPSEGELP QYEGPQDPLSYTRAQPAAPSTPRTEASAPEQSSS
Download sequence
Identical sequences	G3PBR4 ENSGACP00000015038 69293.ENSGACP00000015038 ENSGACP00000015038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]