SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015060 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015060
Domain Number 1 Region: 410-709
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.89e-53
Family Eukaryotic proteases 0.00055
Further Details:      
 
Domain Number 2 Region: 126-240
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-30
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 3 Region: 281-344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000959
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 4 Region: 235-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000107
Family EGF-type module 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015060   Gene: ENSGACG00000011389   Transcript: ENSGACT00000015088
Sequence length 709
Comment pep:known_by_projection group:BROADS1:groupXIX:14035360:14046824:1 gene:ENSGACG00000011389 transcript:ENSGACT00000015088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAYVSVCPLLACMLELLLIPDVLSLLDYRYLYNHCPGPEWNVMCRGCCEYDVIRCKCPLQ
GTPVGYAVPCCRNAINECDPCIIHPGCSIFENCKRCNNGTWSPRDDFFIKGKFCAECRPG
WSGGDCMKCGGVIRKRQGHLVLESYPNNGRCEWTIQVDRPFTIELRFMMMSLEFHPSCRY
DFVEVRDGNSIDSRVIARFCGNSRPAPVHSSGPSLHILFVSDGYKNFDGFFATFQESSAC
SSSPCLHDGTCVLESSYTYRCACLAGYTGKRCENVPVEIDCTLPPKPTHGDHFLVYGPND
VLIALQYLCYQPYELTGSSQRACLPNNTWSGTPPLCTQACREPKVSELVRQRVLPPQVPS
RKTPVHRLYSSGIGRPLKSDSPTRGPPVLSRLPQGFHHLYSHIEYECASPFYHHAGSSRR
TCLKTGKWSGRHVSCSPVCGKHPTFDPERPAEAHWPWLAAIYRRFTNGAGTKVTKADGQL
VCSGALVNQKRVLVAAHCVTELGKVYPLDAAELKVVVGKHYRDDRLKDKGPQHLRVASAV
VHPNYDPHVLDSDIAVVKLLDKAKVGEKVLPLCLSDSQGEEVTSEQGLVTGWSPLPDPSL
GADEKARVGLVHLADVVPCERQYARNGMPVSVTDNMLCASHKPDYGPSNICPSDTGGILV
LPGQGQSGGLWRLMGMVSFGYDQGECDPDLYTVYTRVANFKDWIESNMK
Download sequence
Identical sequences G3PBT6
ENSGACP00000015060 69293.ENSGACP00000015060 ENSGACP00000015060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]