SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015142 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015142
Domain Number 1 Region: 4-65
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000235
Family Growth factor receptor domain 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015142
Domain Number - Region: 168-213
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00017
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number - Region: 57-130
Classification Level Classification E-value
Superfamily FnI-like domain 0.000183
Family Fibronectin type I module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015142   Gene: ENSGACG00000011453   Transcript: ENSGACT00000015170
Sequence length 312
Comment pep:known_by_projection group:BROADS1:groupXII:15236211:15238752:-1 gene:ENSGACG00000011453 transcript:ENSGACT00000015170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPNPPPGSPRESRWSLDGCRCCRVCARQRGEPLHPLPCDGQRGLQCDYSASFHGEPGECV
SREDLRCEVNGITYNEGQSFQPSCDTHCHCRGGGVSCVPACPLNVLLPTPDCPNPQRIRL
PGKCCKEWVCENLDNTVLHDAITATRHGGLWPALPMDRHLNKLVPPASTCTEQSTRWSAC
SRSCGSGVSTRVSNQNPACKLQMETRLCKVRPCHAAQHVSREPMWGLQRRCKASYASPGP
IRLVHQDCHSTRAYQLQYCGRCSDARCCTPHHTTTAEVTFRCPAGRRLQRAVMMIQSCVC
HNNCPYAPHSNP
Download sequence
Identical sequences G3PC18
ENSGACP00000015142 69293.ENSGACP00000015142 ENSGACP00000015142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]