SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015170 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015170
Domain Number 1 Region: 140-422
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.77e-42
Family Eukaryotic proteases 0.0000975
Further Details:      
 
Domain Number 2 Region: 53-105
Classification Level Classification E-value
Superfamily GLA-domain 2.47e-17
Family GLA-domain 0.00082
Further Details:      
 
Domain Number 3 Region: 95-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000115
Family EGF-type module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015170   Gene: ENSGACG00000011445   Transcript: ENSGACT00000015199
Sequence length 424
Comment pep:known_by_projection group:BROADS1:groupXI:10337203:10341562:-1 gene:ENSGACG00000011445 transcript:ENSGACT00000015199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSCTTSAALLCLLAGAMAAVQTPHAVFLDKQQASSVISRQKRNVQPGAGQTSSLEQVCM
EKVCSYEEARKIFQDSYRTDIFWAVYIDGDQCAENPCKNGAMCSDSVGGYDCVCKSGFTG
VHCENDQTLCTWKNKTGCSQFCKPGYTSYECSCARGWKLSRTTRDKCEPAVPYPCGKVYS
LRQWNERVSSNVRSNFEGLSCSSSECPWQALLKAPESAGFCSGVILKENLVLTSAQCTKK
YKSFQVAVGKRSTNSEDGEQLYVKSVHVHPRFKDGHEYDLAVIELRDRITFKREVTAACL
PEKGFAERVLMSGELPAFVTGWKEPNQGSVFEGPLALNQLAYSHLPECLEAHPNLVTNKM
GCTAPQTNADCTMSSGSPLLTLYREVFFLTGVVSNPVGADCSKGYVFQKVSRYLGWLHAL
MGSR
Download sequence
Identical sequences G3PC46
ENSGACP00000015170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]