SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015185 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015185
Domain Number 1 Region: 139-415
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-42
Family Eukaryotic proteases 0.0000975
Further Details:      
 
Domain Number 2 Region: 53-105
Classification Level Classification E-value
Superfamily GLA-domain 2.41e-17
Family GLA-domain 0.00082
Further Details:      
 
Domain Number 3 Region: 95-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000102
Family EGF-type module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015185   Gene: ENSGACG00000011445   Transcript: ENSGACT00000015214
Sequence length 417
Comment pep:known_by_projection group:BROADS1:groupXI:10337235:10341537:-1 gene:ENSGACG00000011445 transcript:ENSGACT00000015214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSCTTSAALLCLLAGAMAAVQTPHAVFLDKQQASSVISRQKRNVQPGAGQTSSLEQVCM
EKVCSYEEARKIFQDSYRTDIFWAVYIDGDQCAENPCKNGAMCSDSVGGYDCVCKSGFTG
VHCENDQTLCTWKNKTGCSQFCKPGYTSYECSCARGWKLSRTTRDKCEPAVPYPCGKVYS
LRHNVRSNFEGLSCSSSECPWQALLKAPESAGFCSGVILKENLVLTSAQCTKKYKSFQVA
VGKRSTNSEDGEQLYVKSVHVHPRFKDGHEYDLAVIELRDRITFKREVTAACLPEKGFAE
RVLMSGELPAFVTGWKEPNQGSVFEGPLALNQLAYSHLPECLEAHPNLVTNKMGCTAPQT
NADCTMSSGSPLLTLYREVFFLTGVVSNPVGADCSKGYVFQKVSRYLGWLHALMGSR
Download sequence
Identical sequences G3PC61
ENSGACP00000015185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]