SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015330 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015330
Domain Number 1 Region: 779-840,1466-1614
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.93e-35
Family Tandem AAA-ATPase domain 0.0018
Further Details:      
 
Domain Number 2 Region: 682-745,772-856
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.38e-25
Family Tandem AAA-ATPase domain 0.0031
Further Details:      
 
Domain Number 3 Region: 400-485
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000807
Family Linker histone H1/H5 0.0043
Further Details:      
 
Domain Number 4 Region: 619-683
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000332
Family PHD domain 0.0057
Further Details:      
 
Domain Number 5 Region: 229-288,334-363
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000353
Family Tandem AAA-ATPase domain 0.028
Further Details:      
 
Domain Number 6 Region: 1396-1448
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000234
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015330   Gene: ENSGACG00000011582   Transcript: ENSGACT00000015359
Sequence length 1648
Comment pep:known_by_projection group:BROADS1:groupXV:11297252:11310971:-1 gene:ENSGACG00000011582 transcript:ENSGACT00000015359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRRKRAPPVRVDEDAKKRLNWNMLDDRKNEEIQEAPTCSVPPVDRPPVEAACTSSVRL
TGELPGTSSDSTAASVALTVEPAPKQAHIWKALIGEFAVRPAWVPSDCEQRAFVLHRMGE
QLCLSYSSCDRSSGLQWRPDEDTCAVECSLRVVPLEDLDWMQKRRVVQLCHHAAEGRVKV
GIYLLETGLGNPELLSEGNARMKKANQLMQKLMEYFYDFIIPEVVENEDEQCDTDLERQN
VEELYDYVRHLHQRESREVTYDVQHKALIPVLRPYQSQAVNWMLKREKYKNTSPKAEQIL
HFLWRELITLCGKKLFYNPFTGCLIREFPLAGVEWPGGILADEMGLGKTVEVLALILFHT
RLDLQQEALTLPVGKSVNYFLPPRPLERKREIRCKSEVHPKMKISYPAVRVMLLTAIKEM
RSGKGASVNAIFTYIRATYGYDLLKNRNHIKKTLAKLIDEGLVHRVKGRGLAGSFRLGKN
YKDTKKTLAGAPKPVRMKSVKDKCLMRQILLVCIIELVSDFSVWLELQKHREHAQENVST
ASKGKGRSSSAKLSPHRRPTRSVLSRIGLSSTRMSREKRDSEPEEDLPKTEDVQEERGGA
PQLESQEMETPTRASVAPFNTPDYRFECICGELGLVDYKARVQCMNCQLWQHADCVNYKE
ESRETTPFYCPHCLVAMKPVSTGATLIISPSSICHQWVEEINRHISSSSLRVLVYQGVKK
HGFIQPHMLAEHDVVITTYDVLRSELNYVDIPHSNSKDGRRFRKQKRYMAVPSPLVAVEW
WRICLDEAQMVECPTAKAAEMALRLASVNRWCVSGTPVQRGLEDVYGLVLFLGVDPYWIK
HWWDQLLYRPYRRGNTEPLYNVIAQLLWRSAKKDVIDQIQIPPQTEEVHWLHFSPVEGHF
YHRQHEVCSQDALVKLRKISDWSLKLGSLDRRTVHTILGPLLRLRQACCHPQAVRGEFLP
LQKSTMTMEELLKSLQKKCRVECEEAHRQLVCALNGLAGIHIIRDEFVEATEMYREVLRS
SEEHKGQLKTDSLQRLHATHNLMELLSAKHPGIPPTLRDHRLSEEAEQLRQHYMTKYDSE
VADAHQALQPVLQNIKELKRKVNLKTPWWLDVLQKAIRCSNDDDLVSRIKNELTSSYKQQ
ANKLSMADKFRDACGLQFLLTTQMQDLMESQKTVQDAVKSLEGPASKKVIDEVTICHLRP
MRLPLNNCVFCKADVLFNDYESKLFSHTVKGQTAIFEEMIEDEDGLMDDRLPTTSRGLWA
ASETERSLKAVLSFAKVKRMDPELVEEGNAFMELFENWKKEYKVLHEYWMVLRNHVSAID
ELGMATERLRVRLPDEAKPKLLHIIEPHEVEQNRVKLLNDQAVAKSQLQKKLGQFLYLTN
LEKSQDKSTGGLNPEPCPICARPLGQEWAVLTCGHCFCNECIAIIVEQYSVGSRRRAIKC
AICRQTTSHTEISYVFTTQTSSQDQDIPVKGSHSTKVEAVVRTLKKIQVSDPGAKCLVFS
TWLSVLDIIAKALFDNSMEFSQINGIHKFQENLCSFKYEEKINILLLPLHTGSNGLNIIE
ATHVLLVEPILNPAHELQAIGRVHRIGQTKPTFVHRFLIKSTIEERMQAMLKTADKSHTS
TTMKHSEAAVLTVADLADLFTEDTEHLE
Download sequence
Identical sequences G3PCK6
ENSGACP00000015330 ENSGACP00000015330 69293.ENSGACP00000015330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]