SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015433 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015433
Domain Number 1 Region: 28-183
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-29
Family C-type lectin domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 324-397
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.76e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 260-335
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 386-461
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000012
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 205-265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000389
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 6 Region: 516-580
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000103
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 472-530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000542
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 8 Region: 592-642
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000945
Family Complement control module/SCR domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015433   Gene: ENSGACG00000011663   Transcript: ENSGACT00000015464
Sequence length 643
Comment pep:known_by_projection group:BROADS1:groupVIII:15021467:15028887:1 gene:ENSGACG00000011663 transcript:ENSGACT00000015464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCFGLLQTRGPKTSWISLTFLCSIFCTWTNVECWSYYYSNKTMNWEEARTWCREHYTDM
VAIQNQDEISHLNSWLPKASSYYWIGIRRINKVWTWVGTNKALTPEAANWAIGEPNNLKS
RKRSMASEDCVEMYIKRDSQAGKWNDERCAKSKTALCYTAACKKDLCGHGDCVETINSYE
CACFEGFYGEKCDQVVQCDAEEVTAPDKASVNCIHKYGNFSYDSMCHYSCEEGYQLSMSR
PLTCTASTRWSEPPPTCELVRCPVLSSPAGGSMKCSDPLGPSGYRSTCAFACDEGYVLAG
STSNTLQCEASGIWNASQPLCLAVQCPSLLQPDNGFVSCGDDAGKHQYGNTCSFSCAAGY
LLVGPSKMTCTSAAVWSERKPRCEVVQCPVLSSPAGGSIKCSDPLGPSGYRSTCAFACDE
GYVLAGSTSNKLQCEASGIWNASQPLCLAIGCPAPKIPTSGQITCSPSLSSIASTGTSHP
LGTVCTFSCDEGHELHGAFGMECANPGRWTSAPPNCKAVRCPSLEAPENGHINCSNSEPV
FNSQCTFSCNQDYSLDGHELLTCDRHGEWTTGQKPTCQDIKRYRCQEHNIADPDTGHRSC
LRGKLTSNSTCGLKCYLGFLITGLQDFTCNVTGDWSGPRPHCA
Download sequence
Identical sequences G3PCV9
69293.ENSGACP00000015433 ENSGACP00000015433 ENSGACP00000015433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]