SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015488 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015488
Domain Number 1 Region: 36-99
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000152
Family Ovomucoid domain III-like 0.005
Further Details:      
 
Domain Number 2 Region: 149-227
Classification Level Classification E-value
Superfamily EF-hand 0.000000000228
Family Calbindin D9K 0.071
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015488
Domain Number - Region: 228-269
Classification Level Classification E-value
Superfamily FnI-like domain 0.00136
Family VWC domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015488   Gene: ENSGACG00000011701   Transcript: ENSGACT00000015519
Sequence length 311
Comment pep:known_by_projection group:BROADS1:groupVI:15665904:15669174:1 gene:ENSGACG00000011701 transcript:ENSGACT00000015519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLFFTFPTFLFILSQVCGAADERKAKEVRSVCDRTFCGAGRECVSTDRGEPVCRCLQQCD
VAENWVCGSNGRTYRNHCELHRDACTTQNKIHVQHRARCLAEKPTETDVSPMACFLSHRD
WLRESAMRWIQEEARSGDEASNVTTADALLQTYFKTYDDGDSELDSKEFLSFLKHNETTL
NLTYSSTLEIYECIWSLCVDALIELSDENADWKLSLTEFINCLTPTYHPYERKCALEDEV
FEDGAETRMECNKCVCACGNWVCTALTCNGEHRVEEDVREGAEEEMTEEEWSSRVAELNT
LQDDSAKSNSP
Download sequence
Identical sequences G3PD14
ENSGACP00000015488 69293.ENSGACP00000015488 ENSGACP00000015488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]