SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015582 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015582
Domain Number 1 Region: 3-123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.44e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 83-215
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 273-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000447
Family EGF-type module 0.03
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015582
Domain Number - Region: 237-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000267
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 324-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00739
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015582   Gene: ENSGACG00000011786   Transcript: ENSGACT00000015613
Sequence length 348
Comment pep:novel group:BROADS1:groupVIII:15151890:15155388:1 gene:ENSGACG00000011786 transcript:ENSGACT00000015613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDECALNNGHCQHNCSNGAGGYSCLCDSGYQLDMDGLNCTDVDECLTPDGTCQHICINTQ
GSFRCSCRPGYQLHIDGHTCVDIDECKLQNGGCSHTCTNSPGGHTCHCPPPLLLDTDNLT
CSNVTSCTLRNGGCDHVCTLRAERQVQCRCRAGWQLAENQRSCKDVNECSDFANGGCEQL
CVNHPGGFNCTCRVGYEVRTDDLTKCRPVCNPRCHNYGVCVAPNSCDCPPGYPGHGCSAM
CSPPCAHGGTCMRWNECLCPLGWAGAGCHTALCELPCANGGRCVAPDTCQCPSDYTGPQC
LSQVKMFGYSFSNTQAYIDLAALCTPACKNGGTCVDVNKCTCVGGWQG
Download sequence
Identical sequences G3PDA8
ENSGACP00000015582 69293.ENSGACP00000015582 ENSGACP00000015582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]