SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015931 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015931
Domain Number 1 Region: 1-205,261-347
Classification Level Classification E-value
Superfamily DNase I-like 1.44e-34
Family DNase I-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015931   Gene: ENSGACG00000012039   Transcript: ENSGACT00000015962
Sequence length 350
Comment pep:known_by_projection group:BROADS1:groupXVIII:12932822:12935089:-1 gene:ENSGACG00000012039 transcript:ENSGACT00000015962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYNILSQQLLQDNVYLYQHCPPGLLAWDRRLSNLLDEMRQHDADILCLQEVQEDHYENQ
IKPALQALGRYQCEYKKRTGNKPDGCAVIFKASRLSLLSSNPVEFFRPGDALLDRDNVGL
VLLLRPNGAERRGADPTAFLCVANTHLLYNPNRGDIKLAQLAILLAEIGRLSRLPDGSAN
PVVLCGDFNSTPRSPLYGFLTTGRLDYRGLQRSMVSGQKDTPRGRRVLESPLWSRSLGIN
RQCRYEDVPGAESSSGSATGAPGFKAPPPLYALXRRTHTHTHIVSEMIIDLINLQRESTV
PPSLSGGRALELLGRLSLVGKSEVVEVKGLPNRCHSSDHLPLLASFRFWC
Download sequence
Identical sequences G3PEA7
ENSGACP00000015931 69293.ENSGACP00000015931 ENSGACP00000015931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]