SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016298 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016298
Domain Number 1 Region: 36-96
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000148
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016298   Gene: ENSGACG00000012331   Transcript: ENSGACT00000016330
Sequence length 223
Comment pep:known_by_projection group:BROADS1:groupI:15719846:15727802:1 gene:ENSGACG00000012331 transcript:ENSGACT00000016330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASAPCPSPCGRVTLVCGLLLLASSPLLTAGRLSNCTHPLVLEHGGFRCDPSPCRGFPL
KSSIHFFCEPGYHINNKVRVSRCRHGRWQPPIPACIPNREGPNMRSDDRVNNSMPSMATT
AVGVSIFLLTTTACLVVKSRLIPCQSHSRRSSDQLDLMVDGLPVSLPSYEEAMYSSWGQR
LPAFSAPGGPTQLLLAQEAPSCHPAALNNQDSSNRPPLPSPDN
Download sequence
Identical sequences G3PFC4
ENSGACP00000016298 69293.ENSGACP00000016298 ENSGACP00000016298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]