SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016479 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016479
Domain Number 1 Region: 97-181
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000198
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 1-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000119
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016479   Gene: ENSGACG00000012467   Transcript: ENSGACT00000016512
Sequence length 217
Comment pep:known_by_projection group:BROADS1:groupXX:13763192:13773436:-1 gene:ENSGACG00000012467 transcript:ENSGACT00000016512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDNITVLEGDGVTLRCQIDEEVTHKAWLNRSNILFAGTDKWSLDKRVTLANSNNSDFSIH
IEKVQVTDEGPYICSSQANNNPRIANVYLIVQVAARIVNISKNVSVNEGENVNLFCLAVG
RPEPTVTWKDQKYGLVSDGEFLDITEIKRQQAEDYECITNNGVASPDQRKVKVTVNYPPL
ITDMKTCRPIWGRRPSCAAKPWRSRQPPSSGTKTTTG
Download sequence
Identical sequences G3PFV5
ENSGACP00000016479 69293.ENSGACP00000016479 ENSGACP00000016479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]