SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016640 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016640
Domain Number 1 Region: 403-539
Classification Level Classification E-value
Superfamily TIMP-like 3.77e-31
Family Netrin-like domain (NTR/C345C module) 0.035
Further Details:      
 
Domain Number 2 Region: 182-276
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 356-411
Classification Level Classification E-value
Superfamily BPTI-like 3.97e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0031
Further Details:      
 
Domain Number 4 Region: 292-351
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000936
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.019
Further Details:      
 
Domain Number 5 Region: 95-143
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000108
Family Ovomucoid domain III-like 0.025
Further Details:      
 
Domain Number 6 Region: 8-60
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000379
Family Elafin-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016640   Gene: ENSGACG00000012587   Transcript: ENSGACT00000016674
Sequence length 547
Comment pep:known_by_projection group:BROADS1:groupXI:11922124:11924367:-1 gene:ENSGACG00000012587 transcript:ENSGACT00000016674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMPMSVAKVVYSHAGLCPNDLNPNLWVDAMSTCMRECESDQDCETFEKCCRNVCGNKSC
VASRYIDVKGNKGPIGMPQGATCDKFMCSQQGSECDIWDGQPVCKCRDRCEREPHFTCAS
DGMTYYNKCYMDAEACSKGISISEVTCRYHLTWPNTSPVPAETTLRPTTALQTTLPADIQ
LPTIHGGLTQQAVFVGETASFLCEVSGKPHPQITWEKQLKGKENTIMRPNHVEGNVVVTN
VGQLVIYNAQLQDAGIYTCTAKNVGGSVSSHFPLVVIGKEAKGRNAEGNDTHLPFPAEEC
LKSPDTDDCGEESMTWYYEPKRNNCFTFTYSQCNKNRNHFDAYETCMLSCGGELAAPCSL
PSLQGPCKAYEPRWAYSNSLKKCQSFVYGGCGGNENSFESKEACEEMCPYPKNRKCKTCK
PRAKMVSSFCRSDFVILGRVTELTEEQESGHALVTVEEILRDEKMGLRFFGKEPLEVTLL
NMDWNCPCPNITTTDGQLIIMGDVQNGMAVLQPDSFVGSSSVRRVRKLREVIHKKTCDFL
KDFAVVQ
Download sequence
Identical sequences G3PGB6
ENSGACP00000016640 ENSGACP00000016640 69293.ENSGACP00000016640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]