SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016833 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016833
Domain Number 1 Region: 616-917
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-82
Family Protein kinases, catalytic subunit 0.000000000193
Further Details:      
 
Domain Number 2 Region: 21-195
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.53e-75
Family Ephrin receptor ligand binding domain 0.0000000335
Further Details:      
 
Domain Number 3 Region: 323-529
Classification Level Classification E-value
Superfamily Fibronectin type III 5.57e-43
Family Fibronectin type III 0.0000273
Further Details:      
 
Domain Number 4 Region: 911-983
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.36e-20
Family SAM (sterile alpha motif) domain 0.0000658
Further Details:      
 
Domain Number 5 Region: 253-324,362-382
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000103
Family Growth factor receptor domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016833   Gene: ENSGACG00000012702   Transcript: ENSGACT00000016867
Sequence length 986
Comment pep:known_by_projection group:BROADS1:groupXII:16831066:16847901:-1 gene:ENSGACG00000012702 transcript:ENSGACT00000016867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVLKRLGPKKYCVRLNFSLAEVLMDSTTATAELGWTIQPSQGWEEVSGYDENMNTIRTYQ
VCNVFDSSQNNWVRTKYIRRRGAQRIHVQMKFSVRDCSSIPNVPGSCKETFNLYYYESDS
DTATKLSPPWMENPWVKVDTIAADESFSQVDLGGRIMKINSEVRSFGPVSRSGFYLAFQD
YGACMSLIAVRVFYRKCPRVIQNGAVFPETLSGAESTSLVAARGVCVPNGEEVDVPIKLY
CNGDGEWMVPIGRCMCKAGYEALENGTVCRACVSGFFKAAQGDHKCLQCPINSRTTSEGA
TNCVCRSGYSRSDSDPSQMPCTTVPSAPQNVISIVNETSLRLEWSPPQEGGGREDVVYNI
ICKSCGSGRGGCTRCGDNVQFVPRQLGLTDTSVHISDLLAHTQYTFEIQAVNGVSDQSPY
SPHYTSVNITTNQAAPSAVSIIHQVGRAPNSITLSWSQPDQPNGVILDYELQYYEKNQAE
WNSSLTRSQTNTAVIRGLKSGTIYVFQVRARTVAGFGRISGKMYFQTMTEEEYNSSIQEK
LPLIIGSAAAGVVFIIAITVFIIVCRSRRNPDRPESEYTDKIQHYTSGHMSPGMKIYIDP
FTYEDPNEAVREFAKEIDMTCVKIEQVIGAGEFGEVCSGNLRQPGKREILVAIKALKAGY
TDRQRRDFLSEASIMGQFDHPNIIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFT
VIQLVGMLRGIAAGMKYLCDMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPT
YTSALGGKIPIRWTAPEAIQYRKFTSSSDCWSYGIVMWEVMSYGERPYWDMSNQDVINAI
EQDYRLPPPMDCPSALHQLMLDCWQKDRNNRPKFSQIVSTLDKMIRNPNSLKATTPLSSS
VHLPLLDRTAPDFSSFSVVDEWLDAIKMGQYKENFTNEGFTSFDVVSQMTMEDIIRVGVM
LAGHQKKILNSIQSMRAQMNQITSVE
Download sequence
Identical sequences G3PGV8
ENSGACP00000016833 ENSGACP00000016833 69293.ENSGACP00000016833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]