SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016955 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016955
Domain Number 1 Region: 462-573
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-25
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 2 Region: 278-396
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-16
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 3 Region: 579-644
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 639-700
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000375
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 104-222
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000615
Family Spermadhesin, CUB domain 0.0091
Further Details:      
 
Domain Number 6 Region: 707-766
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000011
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 221-285
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 401-466
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000405
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016955   Gene: ENSGACG00000012825   Transcript: ENSGACT00000016989
Sequence length 867
Comment pep:known_by_projection group:BROADS1:groupXI:12495652:12504313:1 gene:ENSGACG00000012825 transcript:ENSGACT00000016989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTPPTSTPDSYPLGDLIHAALQSKEYLGDAPASTGTTTNPTQAVPGLGQTDSTATVMSPG
LLTTALSSSSAASRKGSRNAMSSLPVEEETTTTLITTTTITTMHMPVQCNATLSAMEDVV
ESPDPATVSSSFSPLECTYSITVYAGYGVEIQVRKVNLSKKESLTIMGHGGSAPELLANE
TLMREGQVIRSTTNQVYIHYRSLQPSNHGVFSLHYQAFLLSCPFPLSPVGGGVTVTDIHP
GGQAHFHCDPGFQVRGHEVATCVNTTQPHWSTAEPQCVAVSCGGWVRNATVGRILSPPPP
SVGNHSNGNNLSCHWLIEAKEGHRLHLHFERIALDEDDDKLIVRSGNSSLSQPLFDSDLD
DVPERGLLSESSTLYLELTADSSSIPLLLALRYEAFDDEHCWEPFIPHGNFSSSDITYQL
GTTVAFTCSPGFVMEQGSGTIECVDPSNPHWNDSEPVCRALCGGELTEPSGTILSPDWPQ
SYSKGLDCVWQIHGNEEKRIELDVQILNIRHTDVLTVFDGRDLMSHVIAQYMGSRERFQV
VSGGSEVTIQFQSDPDDSSFILSQGFLIHYREVEPNDTCPTLPQIDFGWISSSHSSPVRG
SVLTYQCQPGYDISGSDIITCQWDLSWSSSPPTCVKVQQCPDPGEVVNGARSVRPETGFA
VGTVVRFSCNQGYQLEGPSQISCHGRDTGTPKWSDRGPKCVLKYDPCPNPGVPDNGYQTL
YKHSYQAGETLRFFCYEGYELIGEVIISCVPGHPSQWNSPPPFCKDHTVAYDDLLDDHKL
QVSVPFEPSHQILSENIALAIILPIILVILLIGGIYMYYTNICRLEWKPLFWKSLSHTHS
YSPITVESDFNNPLYEAGDTREYEVSI
Download sequence
Identical sequences G3PH80
69293.ENSGACP00000016955 ENSGACP00000016955 ENSGACP00000016955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]