SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016958 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016958
Domain Number 1 Region: 376-487
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-25
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 2 Region: 192-310
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-16
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 3 Region: 493-558
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000124
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 553-614
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000032
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 18-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000051
Family Spermadhesin, CUB domain 0.0091
Further Details:      
 
Domain Number 6 Region: 621-680
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000721
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 135-199
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000126
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 315-380
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000347
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016958   Gene: ENSGACG00000012825   Transcript: ENSGACT00000016992
Sequence length 765
Comment pep:known_by_projection group:BROADS1:groupXI:12496020:12504313:1 gene:ENSGACG00000012825 transcript:ENSGACT00000016992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEETTTTLITTTTITTMHMPVQCNATLSAMEDVVESPDPATVSSSFSPLECTYSITVYAG
YGVEIQVRKVNLSKKESLTIMGHGGSAPELLANETLMREGQVIRSTTNQVYIHYRSLQPS
NHGVFSLHYQAFLLSCPFPLSPVGGGVTVTDIHPGGQAHFHCDPGFQVRGHEVATCVNTT
QPHWSTAEPQCVAVSCGGWVRNATVGRILSPPPPSVGNHSNGNNLSCHWLIEAKEGHRLH
LHFERIALDEDDDKLIVRSGNSSLSQPLFDSDLDDVPERGLLSESSTLYLELTADSSSIP
LLLALRYEAFDDEHCWEPFIPHGNFSSSDITYQLGTTVAFTCSPGFVMEQGSGTIECVDP
SNPHWNDSEPVCRALCGGELTEPSGTILSPDWPQSYSKGLDCVWQIHGNEEKRIELDVQI
LNIRHTDVLTVFDGRDLMSHVIAQYMGSRERFQVVSGGSEVTIQFQSDPDDSSFILSQGF
LIHYREVEPNDTCPTLPQIDFGWISSSHSSPVRGSVLTYQCQPGYDISGSDIITCQWDLS
WSSSPPTCVKVQQCPDPGEVVNGARSVRPETGFAVGTVVRFSCNQGYQLEGPSQISCHGR
DTGTPKWSDRGPKCVLKYDPCPNPGVPDNGYQTLYKHSYQAGETLRFFCYEGYELIGEVI
ISCVPGHPSQWNSPPPFCKVSVPFEPSHQILSENIALAIILPIILVILLIGGIYMYYTNI
CRLEWKPLFWKSLSHTHSYSPITVESDFNNPLYEAGDTREYEVSI
Download sequence
Identical sequences G3PH83
ENSGACP00000016958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]