SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017142 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017142
Domain Number 1 Region: 5-193
Classification Level Classification E-value
Superfamily vWA-like 1.67e-54
Family Integrin A (or I) domain 0.00035
Further Details:      
 
Domain Number 2 Region: 194-232,265-354
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000377
Family Growth factor receptor domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000017142
Domain Number - Region: 359-395
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.000589
Family Chicken cartilage matrix protein 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017142   Gene: ENSGACG00000012967   Transcript: ENSGACT00000017176
Sequence length 406
Comment pep:known_by_projection group:BROADS1:groupXV:14277830:14284505:-1 gene:ENSGACG00000012967 transcript:ENSGACT00000017176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIRSNCRNRPIDLVFVIDSSRSVRPGEFEKAKEFLQDMVDSLEIGPGATQVGLVNYASTV
HIEFLLKTYYAKSALKQALARVEPLASGTMTGTAIKTAMEKAFTEEGGARPSSENIAKVA
IIVTDGRPQDKVEDVSAAARASGIEIYAVGVGRADMTSLRLMASLPHDDHVFYVETYGVI
EKLTSKFRETLCGLDPCDQGHNCQHICVNNDYSYDCKCRKGYVLNPDKKTCSLTFGCPKQ
MDTHNSAQNQKTCSHENIDFSGSDACAQGHDCQHICVTNGNSYICRCGVGYVLNVDQKTC
SRRCRAESAGWDVGFDHVLDGHDCQQICINNGHSFNCKCQVGYVLNADQKTCSQELRSEI
TQDACMCEAQIVFQKKVQYAIQELGRKNILLTTRKKVRMSKIRRAI
Download sequence
Identical sequences G3PHR6
ENSGACP00000017142 69293.ENSGACP00000017142 ENSGACP00000017142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]