SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017144 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017144
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily vWA-like 1.31e-54
Family Integrin A (or I) domain 0.00035
Further Details:      
 
Domain Number 2 Region: 189-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000217
Family EGF-type module 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000017144
Domain Number - Region: 236-264
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00144
Family Chicken cartilage matrix protein 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017144   Gene: ENSGACG00000012967   Transcript: ENSGACT00000017178
Sequence length 267
Comment pep:known_by_projection group:BROADS1:groupXV:14278213:14284490:-1 gene:ENSGACG00000012967 transcript:ENSGACT00000017178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRNRPIDLVFVIDSSRSVRPGEFEKAKEFLQDMVDSLEIGPGATQVGLVNYASTVHIEFL
LKTYYAKSALKQALARVEPLASGTMTGTAIKTAMEKAFTEEGGARPSSENIAKVAIIVTD
GRPQDKVEDVSAAARASGIEIYAVGVGRADMTSLRLMASLPHDDHVFYVETYGVIEKLTS
KFRETLCGLDPCDQGHNCQHICVNNDYSYDCKCRKGYVLNPDKKTCSRKYQELRSEITQD
ACMCEAQIVFQKKVQYAIQELGRKNIL
Download sequence
Identical sequences G3PHR8
ENSGACP00000017144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]