SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017280 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017280
Domain Number 1 Region: 25-285
Classification Level Classification E-value
Superfamily DNase I-like 8.24e-35
Family DNase I-like 0.000000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017280   Gene: ENSGACG00000013035   Transcript: ENSGACT00000017314
Sequence length 302
Comment pep:known_by_projection group:BROADS1:groupXII:17640782:17644272:-1 gene:ENSGACG00000013035 transcript:ENSGACT00000017314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRASFLLLLLTFLVGLCDVEGDTDFRVCAFNLHHFGDSKSKKTNVMHTLVRIIARCDVCL
LQEVRDSQELAVPQLLRRLNSYDPEHDYASVSSERLGRTASYQEQYVFVYRTDTATLTGQ
YQYPDDRPGDVDAFAREPFVVRFNAPRTDIREFVLIPQHTTPTNTTKELDALYDVLQHVK
TMWETEDVMLLGDFNADCAYLAKKNRKYVRLLTQSELYWLIPEKADTTVRSTTSCTYDRI
VVHGERFSRAIVPFSAKPFNFQLEYRLTEEQALEVSDHYPVEVLLKDIAYKTFLRRKENQ
KP
Download sequence
Identical sequences G3PI53
ENSGACP00000017280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]