SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017340 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017340
Domain Number 1 Region: 567-828
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.08e-89
Family Eukaryotic proteases 0.00000231
Further Details:      
 
Domain Number 2 Region: 315-425
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-27
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 3 Region: 198-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-23
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 4 Region: 56-147
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000000222
Family SEA domain 0.01
Further Details:      
 
Domain Number 5 Region: 431-466
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 502-536
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 7 Region: 466-502
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017340   Gene: ENSGACG00000013091   Transcript: ENSGACT00000017374
Sequence length 829
Comment pep:known_by_projection group:BROADS1:groupI:16837820:16847208:-1 gene:ENSGACG00000013091 transcript:ENSGACT00000017374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WDTNIQFLPASDNKKLEKKKGPGIVGAVIGVVIFAAVIALMTGLLVWHFHFRNDVRLKRM
YSGSMRITNQGFIDAYENSNSSEFKALARQVTSQLKSIYSKSPQLAKYYVGSTVQAFSEG
SVISYYLSEFDVPQGQEASVDSAMSSMDKLVDKEQRRVARPSNSLVLEDVRSSALDTRLL
STPFSRYMQFSMHTKPNEIGQIQSPGFPNSAYPPNTFIQWQLRADPKHIIKLDFDTMNLE
EDCSNDFIKIYDSLVAIESSVMDEMCGYHSPSQPLTFLSSGNVMLVTMASDKENDYPGFR
AKVSQVPRGSKAVTCGGNLMGEKGTFTSPNFPSYYPPRNLCQWSIQVPNGNAVKLTFKTF
LLSEPGQKDGEDCLKDYVQVNGKKFCGEKPEGTVTETSQTNTMEVVFFSDASYVDRGFNA
SYEAINAKDPCPKQFQCRNQRCIKTELQCDGWNDCGDMSDELDCKCKPQDISCKNGLCKP
MFWKCDGVDDCGDQTDELNCGCKSGLVTCKNNECVSEKHLCDGIDNCGDGSDELNCGRST
GVLCSDLTYKCKNNKCIDTVNPECDGTPDCEDGSDEENCDCGRSLFKTSRIVGGENTQDG
EFPWQVSLHVKGAGHVCGASIISPQWLVTAAHCVQDDPRTRYSQPGTWEAYLGLHIQGNT
AKNVVKRNLKQVIAHPNYNAYTYDNDIALMELDSPVTYSDYIRPICLPSPQHDFPAGSTV
WITGWGATREGGFAAKVLQKAEVRIINYSVCNDLMKAQLTSRMLCAGVLTGGVDACQGDS
GGPLSSPSGSRMFLAGVVSWGDGCARRNKPGIYTTVTKFRGWVKEKTGV
Download sequence
Identical sequences G3PIB3
ENSGACP00000017340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]