SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017348 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017348
Domain Number 1 Region: 6-141
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-17
Family APC10-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017348   Gene: ENSGACG00000013111   Transcript: ENSGACT00000017382
Sequence length 144
Comment pep:known_by_projection group:BROADS1:groupVIII:16960039:16961679:-1 gene:ENSGACG00000013111 transcript:ENSGACT00000017382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSLICSETQSRVSSVLNRDVKQYGKKFMFDCNEETCWNSDQGESQWVSLEFPRPVKVS
EIKVQFQGGFSAKTCRLDGCPKDGAFAEISHFYPEDNNSLQISFRLPVQEAPAVDKVKIK
FENSGDFFGRVIVYSLDVLGEKTS
Download sequence
Identical sequences G3PIC1
ENSGACP00000017348 69293.ENSGACP00000017348 ENSGACP00000017348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]