SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017416 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017416
Domain Number 1 Region: 970-1261
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.33e-79
Family Protein kinases, catalytic subunit 0.000000000272
Further Details:      
 
Domain Number 2 Region: 326-486
Classification Level Classification E-value
Superfamily L domain-like 3.12e-48
Family L domain 0.00000282
Further Details:      
 
Domain Number 3 Region: 33-194
Classification Level Classification E-value
Superfamily L domain-like 1.19e-39
Family L domain 0.00000164
Further Details:      
 
Domain Number 4 Region: 482-601
Classification Level Classification E-value
Superfamily Fibronectin type III 6.84e-31
Family Fibronectin type III 0.0000233
Further Details:      
 
Domain Number 5 Region: 603-683,786-805
Classification Level Classification E-value
Superfamily Fibronectin type III 4.01e-21
Family Fibronectin type III 0.00086
Further Details:      
 
Domain Number 6 Region: 780-924
Classification Level Classification E-value
Superfamily Fibronectin type III 8.02e-18
Family Fibronectin type III 0.00018
Further Details:      
 
Domain Number 7 Region: 234-335
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000911
Family Growth factor receptor domain 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017416   Gene: ENSGACG00000013170   Transcript: ENSGACT00000017450
Sequence length 1413
Comment pep:known_by_projection group:BROADS1:groupXIX:16907878:16962832:1 gene:ENSGACG00000013170 transcript:ENSGACT00000017450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCDTRMRSATLFWGLMLSFSICIWSTHGEICGPSIDIRNDIEEFKRLLNCTVVEGYLQI
LLITDKTNNIQQEAFRSLSFPKLTVITDYLLLFRVSGLDSLSMLFPNLSVIGGRNLFYNY
ALVIYEMTSLKDIGLYNLRNITRGALRIEKNPELCYLDSVDWSLIMDAEFNNVINGNKKA
KECDNVCPGIMEDNPLCRRTSFNDNLDYRCWTSSQCQKVCPEHCKLACTDQGECCHSQCL
GSCTEPNNDMACSGCLHYYHEDRCVPDCPPDTYKFEGWRCITMDLCSQVHLPGDTPFVIH
GGECMLDCPSGFTREANRMFCTPCNGLCDKVCTSPIIDSVNAAQSLKDCTIIEGNLDINI
RRGNNIASELESFMGLIQTVTGYVKIRHSHALGSLSFLKSLRYISGQELIDNMYSFSAID
NQHLQYLWDWSQHNLTIENGRLFFRLNPKLCMIEIHNMWENTGIAVKPEKGDFRNNGERA
SCESHVLKFKSNITTSHSMRLTWERYAPQGYSDLISFVVYYKESPFQNITEFDGQDGCGS
NSWHMVDVDLPQDKINDPKVSLQQLKPWTQYAIFVKAITLQVENKHITGAKSDIIYIRTR
PSPPSMPKDARAFANSSTTLMVKWSPPAFPNGNLTYYLVRWQQQPEDRELYQHNYCSKEL
KVPIRLPATGFTDMEDNTKPTKSDLAGGDKGPCCKCQKTPEEKDREKDDRVFLKIFENFL
HNAIFLPRPPDRRRRDVFGSANDTLLHHGVGRGNSTIGPEDNSTDGIPPIREFPFSEDKS
TAEYLEILNLRPFTVYRIDIHACNEEVGRCSAGAFVFSRTKPAGKADDIPGKVTNGRSDK
VEGCVVLHWPEPFMPNGLILMYEIKFRLETEPEKHECVSRQQYRLYQGARLTNLGSGNYS
ARVRATSLAGNGSWTDRVFFYVPPPKRDDGVAFYLVIIIPIIVTLFIATLTTVVFFVNKK
RNSDRLGKGVLYASVNPEYFSAAEMYVPDEWEVAREKITMHKELGQGSFGMVYEGLAKGV
VKDEQETRVAIKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMEL
MTRGDLKSHLRSLRKENATSQVLPPLKKMIQMAGEIADGMSYLNANKFVHRDLAARNCMV
AEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTMSDVWSFGVVLW
EIATLSEQPYQGMSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEII
SSIKEDLDPPFREMSFFFSEENKPPDTEELDMEVENMENIPLDPAPTRQPPTTAATAPSS
GCVVGGTPPPAAQQLSPMQGPGTPLLGPMSPASPGRVASASPGQASDKPSGHVSANGPAV
VLRPNFDELQPYAHMNGGRKNERALPLPQSSAC
Download sequence
Identical sequences G3PII8
ENSGACP00000017416 ENSGACP00000017416 69293.ENSGACP00000017416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]