SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017595 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017595
Domain Number 1 Region: 163-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000033
Family EGF-type module 0.019
Further Details:      
 
Domain Number 2 Region: 74-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000122
Family LDL receptor-like module 0.0045
Further Details:      
 
Domain Number 3 Region: 32-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000559
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017595   Gene: ENSGACG00000013314   Transcript: ENSGACT00000017629
Sequence length 281
Comment pep:known group:BROADS1:groupXIII:16276667:16278070:-1 gene:ENSGACG00000013314 transcript:ENSGACT00000017629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WYRDEHKEHKLWFEVDTEVISLKAFSKSSQTGSNHCSENNGNCHHLCLATPAGRTCRCAH
DQILLNATHCGPARHCSDGSRQCLDRLSCQAIEKFCNGLVDCHDHSDENCAGLKPSTGVA
VVAPTQPHSSSPPPSSLPAVNLSEVTGLNSTLGVSVLVKNLDAQKCSHSRCSGNGRCVET
DGSTACVCSLAYSGESCQDHILKAMQGPIIYGGAGLCAGVVIIVMVAVLVKRRRANTRSG
STAEGNETTMKNLVNKAEAPASTDSSPADANKPEEAVSLVG
Download sequence
Identical sequences G3PJ16
69293.ENSGACP00000017595 ENSGACP00000017595 ENSGACP00000017595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]