SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gasterosteus aculeatus 76_1 > ENSGACP00000017603

Domain assignment for ENSGACP00000017603 from Gasterosteus aculeatus 76_1

Domain assignment details

(show help)
Strong hits

Sequence:	ENSGACP00000017603
Domain Number 1	Region: 400-665
Classification Level	Classification	E-value
Superfamily	YWTD domain	1.96e-38
Family	YWTD domain	0.0000414
Further Details:

Domain Number 2	Region: 345-394
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000000000549
Family	EGF-type module	0.0041
Further Details:

Domain Number 3	Region: 230-266
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000589
Family	LDL receptor-like module	0.00092
Further Details:

Domain Number 4	Region: 65-101
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000183
Family	LDL receptor-like module	0.0018
Further Details:

Domain Number 5	Region: 144-181
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000196
Family	LDL receptor-like module	0.0017
Further Details:

Domain Number 6	Region: 24-62
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000484
Family	LDL receptor-like module	0.0015
Further Details:

Domain Number 7	Region: 109-140
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000183
Family	LDL receptor-like module	0.0018
Further Details:

Domain Number 8	Region: 195-226
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.00000038
Family	LDL receptor-like module	0.0016
Further Details:

Domain Number 9	Region: 316-356
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00000148
Family	EGF-type module	0.03
Further Details:

Domain Number 10	Region: 277-309
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.00000288
Family	LDL receptor-like module	0.0022
Further Details:

Weak hits

Sequence:	ENSGACP00000017603
Domain Number -	Region: 670-706
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.000973
Family	EGF-type module	0.0076
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

(show help)

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGACP00000017603 Gene: ENSGACG00000013316 Transcript: ENSGACT00000017637
Sequence length	706
Comment	pep:known_by_projection group:BROADS1:groupXIII:16279207:16285577:-1 gene:ENSGACG00000013316 transcript:ENSGACT00000017637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MGGCMRLCAVLLLWSGLLQVHSISLKCGRGSRMCKDGSDCIPYNELCDGELDCKDGSDEE DCASECIKDQFQCAHGKKCIDEDQVCDGVPQCQDRSDEMHCKKQSESCVHHCDQNRRCVP ATFLCDGEKDCLDGSDETNCGTPIKCQLGSRPCQNKFQCVPYNHFCDGEADCKDGSDEEE CALSCETGNLMTGCDHQCDDNLHCIPKSFLCDGERDCVDLSDEANCAEMGCSPTEFQCVS GQCMSATMFCDGHPDCQDHSDEDDCATAPVCTTKHSCPQSKQFQCGSQDCVDQIHVCNHN ADCADGSDEGVSCEIKCAADSRCSQGCYNTPRGPHCRCAAGFRLMEDGLTCADIDECEDR WPSMCSQLCINTQGSYKCDCHPGYIMETAGRHCKITGEPLLLLSIQTNLFLFGLRSGSLD MLPSSSAEKAILSLDYDWRDQKVFWVSLDTDGIRWSSLDQKSTGTVIKGVRADSIAVDWL GRNMYWIDGVNSQIVAIRLRKGTVKSVDHSIILDEDLDQPRSLALLPQKGLMFWTEIGNV AKIERAGMDGSQRIAVVNSSLGWPGGVAVDAISERVYWTDERLRAIGSATLAGDDIQVTA FERGYLMKETNNPFSLAVFNDMLYWADARKRVVLAAHKNSGKNLKVLLKRPGQPFGVKVL HPFLQMGVENPCEKISCSHMCVFAPGPKAVCKCPAGLILAEDGLAC
Download sequence
Identical sequences	G3PJ24 69293.ENSGACP00000017603 ENSGACP00000017603 ENSGACP00000017603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]

SEARCH

BROWSE

TOOLS

ABOUT

HELP

Domain assignment for ENSGACP00000017603 from Gasterosteus aculeatus 76_1

Domain assignment details

Gene Ontology term assignment details

Protein sequence