SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017637 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017637
Domain Number 1 Region: 144-213
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000025
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 2 Region: 204-266
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 39-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000145
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 4 Region: 85-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000193
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000017637
Domain Number - Region: 375-412
Classification Level Classification E-value
Superfamily Photosystem I reaction center subunit XI, PsaL 0.0144
Family Photosystem I reaction center subunit XI, PsaL 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017637   Gene: ENSGACG00000013341   Transcript: ENSGACT00000017671
Sequence length 706
Comment pep:known_by_projection group:BROADS1:groupXIII:16303474:16312396:1 gene:ENSGACG00000013341 transcript:ENSGACT00000017671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDVCATCHADATCDDKPDGPGKVCNCKYGFVGNGRTFCQDKDECQIGASKICGQHTTCHN
TYGSYYCTCLAGFSPSNNLTVFIPNDGTHCQDDDECRIAGVCGEGARCRNLEGSFDCSCQ
LGYQVHNGLEPFNPHSDNASCREVDCGPPPPLPHSHTVWSQSSRMGTEVVYQCNSGFHNV
GTGDVSTCTSAGQWEGPSMLCQEIVCGSPPIIESTEQVWDGHSTPGSTVLYVCKEGFYYK
DGLNISMCNENGQWTPPTLTCQGVTTSSPYCTLNFELLIRISARGSWVRIDPKKSARLAA
RCDQNEMVLEHTLLGRATQQPTLCITLYPRHIVWGSTCTASHWTHMEWQLQPWKRSDLLL
DGNNMSLCSINGYWTKTNFSCKDEWKQYFNMFTIGTVGGSICKFYIVKVMRLIVEETTRC
VCYATTAFTTRAKKILSVQWVNQRHSFPPEIKPPVNHLSVLNEKCLRWRAAKYEEDKEVY
QVTYEGSREYQRSFHDRGKQRLSSTADQLELCLNLLPVTNYSISITALSSRFTATISTNT
SLTVPPAPVVYYSEFETPVPTLRLRRSPDTLDPISLYQVFVLPVEGIVMFDCSSPASSDI
SRKIKSSAEYITAQIDVGHLGREMNFTVGDGLYYGGFFNAPLQNGRNYYVIVRAVSQWKS
ALKSVCVLWAKVRGTSYVLRVSSLSAAASVGLVAVVILVFLEFSDK
Download sequence
Identical sequences G3PJ58
69293.ENSGACP00000017637 ENSGACP00000017637 ENSGACP00000017637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]