SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017694 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017694
Domain Number 1 Region: 143-552
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.41e-78
Family L-arabinose binding protein-like 0.0019
Further Details:      
 
Domain Number 2 Region: 79-133
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000653
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 29-76
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000751
Family Complement control module/SCR domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017694   Gene: ENSGACG00000013381   Transcript: ENSGACT00000017729
Sequence length 964
Comment pep:known_by_projection group:BROADS1:groupXX:16157637:16204638:-1 gene:ENSGACG00000013381 transcript:ENSGACT00000017729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVGCAIIRPPRDGGIRYRGLTQEQIRSVQILPVDYEIEYICRGNRVIVGPKVRKCLPNGT
WTDITLNSTCLLLCPRVWTSLENGRVTVKPPGPPVEGTVLHYSCHAGFILEGRNISHCTK
LGKWDAPKPTCLFNTFTHKSKKKLYIGALFPMSGGWHGGQACMPSAQMALDLVNNRSDIL
PDYELELIHYDSMCDPGEATKLLYDLLYTEPIKIVLLPGCSGVSTLVAEAARMWNLIVTS
RGSRSPALSKRQRFPTFFRTHPSATLHKPPRVQLFQKWKWTRIATIQQNTEVFTSTLDDL
EERTKEAGIEISVRQSFLTDPAVAVKNLKRQDARIIVGLFYETEARKVFCEVFKEKLYGK
KYVWFLIGWYADNWFKIKDPAINCTVENMTEAVEGHVTTEIVMLNPETVRGVSNMTSQEF
IAALMSRLGGKNPEETGGFQEAPLAYDAVWALALALNKTVAPLKAKGRRLEDFNYNNHDI
TSEIYRALNTSSFEGVSGQVVFDAQGSRMAMTLIEQLQGGSYKKIGYYDSSQKNLSWFGN
DVWIGAGPPADRTVVIEVYRFLSQKLFAAVSVFAGLGILFGIVCLTFNIYNGNVRYIQNS
QPYLNNMTAVGCMMALAAVFPLGIDGHHVHRSQFPVVCQFRLWLLGLGFSLAYGSMFTKI
WWVHTLFTKKDEKKEYRQHLEPWKLYATVGVLLAIDFLSLMIWQIVDPLHITVEKFTKEA
PKEDLDVLIQPLLEHCSSEKMNTWLGIHWAYAVLRSLNGRRTHIILCPPPLSVGVVYGYK
GLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDASFAFA
ALAVVFSAYITLVVLFVPKMRRLITRGEWQSEQQDTLKTGSSTNNNDEEKSRQLERENRE
LQKIIQEKEERVSALRNQLAERQALRNRRQPSSGQNQNHNTPPPSTQPPDPNHCHNSQIP
LLYK
Download sequence
Identical sequences G3PJB5
ENSGACP00000017694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]